BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10840 (766 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 25 1.9 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 24 4.5 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 25.4 bits (53), Expect = 1.9 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = +1 Query: 49 NQLQKRKKVTNNDEIAGQMPVIKRRKITEQQVQRPESKGPLVLFPSDSEDD 201 +Q Q++++ +AG + R +QQ+QR P ++ S SE + Sbjct: 303 HQQQQQQRQPQRQAVAGSQQQQQERMQQQQQLQRKRKPRPDIIEVSPSEGE 353 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 24.2 bits (50), Expect = 4.5 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +1 Query: 541 GGARTSTICKVLEADRGPMEF*GPPTKRLPCTLTPDVRSG 660 GG R + L R PM GPP +P TPD G Sbjct: 76 GGGRAGSDEDELPQPRQPM---GPPVPGVPIMTTPDPDCG 112 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 747,210 Number of Sequences: 2352 Number of extensions: 15490 Number of successful extensions: 33 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -