BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10839 (688 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 23 2.7 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 22 4.8 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 4.8 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 22 6.3 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 21 8.3 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +3 Query: 330 EKDSNANNNKETSEPLQQPIGETVNVETG 416 E + NNKE SE +Q + + ++ +TG Sbjct: 475 ENLGDGRNNKEDSEEFRQRLRKELDSKTG 503 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 424 NDSPVSTFTVSPIGCCKGSLVSLLLFALESF 332 N SPV TV CC+G ++ + + F Sbjct: 335 NRSPVRPATVQYDTCCQGRATAIYIDKVSRF 365 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +3 Query: 288 NLHPNYENANQETGEKDSNANNN 356 N NY N N ++N NNN Sbjct: 328 NYKYNYNNNNYNNNNYNNNYNNN 350 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.8 bits (44), Expect = 6.3 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 244 PTMQNLLKLQDWLGLTFIPIMKMPIRKQVRKT 339 P M N L LGL +++M ++ QV T Sbjct: 51 PVMNNTETLTVQLGLKLSQLIEMNLKNQVMTT 82 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 247 TMQNLLKLQDWLGLTFIPIMK 309 TM LL W TF+ IMK Sbjct: 60 TMNYLLDTDQWGDKTFVIIMK 80 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,393 Number of Sequences: 438 Number of extensions: 3087 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -