BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10822 (486 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF039041-1|AAP46271.1| 1067|Caenorhabditis elegans Laminin relat... 32 0.19 AL021487-10|CAA16357.2| 1592|Caenorhabditis elegans Hypothetical... 28 3.1 >AF039041-1|AAP46271.1| 1067|Caenorhabditis elegans Laminin related. see also lmb-protein 1 protein. Length = 1067 Score = 32.3 bits (70), Expect = 0.19 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = +1 Query: 136 SCISGKRGRRC--CNIWHWGSVDSISGSRARFQLSGNSGRKQAAAAQAYYG 282 +C SG +G RC C HWGS + G+ R +GN + A G Sbjct: 973 NCKSGYQGERCGECAQNHWGSPREVGGTCERCDCNGNIDMAMEGSCDAATG 1023 >AL021487-10|CAA16357.2| 1592|Caenorhabditis elegans Hypothetical protein Y45F10B.10 protein. Length = 1592 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -1 Query: 333 YHGSSSQL*HNAAGH*ISVVCLCSS 259 YH +S QL GH +V CLCSS Sbjct: 896 YHIASEQLIGTFKGHTAAVTCLCSS 920 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,901,421 Number of Sequences: 27780 Number of extensions: 186928 Number of successful extensions: 425 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 425 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 903458030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -