BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10817 (766 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 23 2.4 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 23 2.4 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 22 7.2 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 22 7.2 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 7.2 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.5 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 23.4 bits (48), Expect = 2.4 Identities = 7/25 (28%), Positives = 13/25 (52%) Frame = -1 Query: 157 PWPHHVFHPSVEQDILAKV*WISRH 83 PW + + HP Q++ + W+ H Sbjct: 333 PWIYAINHPRYRQELQKRCKWMGIH 357 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 23.4 bits (48), Expect = 2.4 Identities = 7/25 (28%), Positives = 13/25 (52%) Frame = -1 Query: 157 PWPHHVFHPSVEQDILAKV*WISRH 83 PW + + HP Q++ + W+ H Sbjct: 333 PWIYAINHPRYRQELQKRCKWMGIH 357 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.8 bits (44), Expect = 7.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 698 PIYLHFLVNKKLQGGVNHLPYP 633 P L+ + NKK +GG PYP Sbjct: 93 PSSLNVVTNKKGKGGPLLRPYP 114 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.8 bits (44), Expect = 7.2 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -2 Query: 297 QHCFDHAGELHLH 259 + F+H+G+LH H Sbjct: 154 ERAFEHSGKLHRH 166 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 7.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +3 Query: 393 NVSKEDKAEAKIKRVFKKHPLNVQVSVKAEDGTAL 497 ++S E+ K +K P + SVKAE G+ + Sbjct: 868 SISHENNQPTMNKCSDRKRPASQATSVKAEPGSIM 902 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 9.5 Identities = 6/15 (40%), Positives = 13/15 (86%) Frame = +2 Query: 116 VLLYAWMKNVMRPGP 160 +LLY++++ ++PGP Sbjct: 423 MLLYSFIEQTLQPGP 437 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 9.5 Identities = 6/15 (40%), Positives = 13/15 (86%) Frame = +2 Query: 116 VLLYAWMKNVMRPGP 160 +LLY++++ ++PGP Sbjct: 423 MLLYSFIEQTLQPGP 437 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,239 Number of Sequences: 438 Number of extensions: 3753 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -