BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10814 (286 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_02_0057 + 7851500-7852041,7852190-7852622,7853702-7854496 28 1.3 12_02_0188 - 15158824-15159215,15159299-15159809,15159885-151600... 27 3.1 12_02_0078 + 13290432-13290924,13290998-13291201,13291290-132920... 26 5.4 12_02_0925 - 24398851-24398998,24399478-24399718,24399886-244005... 25 7.1 09_04_0256 + 16148820-16148998,16149547-16150241,16150317-161505... 25 7.1 09_04_0144 + 15071723-15071993,15072078-15072632,15072671-150726... 25 7.1 08_01_0463 - 4075037-4075316,4075997-4076151,4076818-4078861,408... 25 7.1 07_03_1652 - 28409097-28409165,28409788-28409911,28410317-284105... 25 7.1 07_03_0014 - 12428713-12428860,12429340-12429580,12429664-124303... 25 7.1 05_01_0595 + 5344721-5345249,5349183-5349264,5349813-5350507,535... 25 7.1 03_03_0039 - 13986844-13986907,13987219-13987273,13987492-139876... 25 7.1 02_05_1149 + 34471730-34471790,34471975-34472056,34472605-344732... 25 7.1 02_05_1110 - 34182943-34182963,34183122-34183301,34184201-341845... 25 7.1 01_05_0117 - 18300157-18301106,18301149-18301543,18302592-183026... 25 7.1 10_05_0114 + 9294747-9294788,9294883-9294996,9295066-9295173,929... 25 9.4 04_04_1109 + 30965143-30965312,30965406-30965586,30965669-309661... 25 9.4 01_01_0631 - 4752606-4752706,4754039-4755578 25 9.4 >11_02_0057 + 7851500-7852041,7852190-7852622,7853702-7854496 Length = 589 Score = 27.9 bits (59), Expect = 1.3 Identities = 12/46 (26%), Positives = 21/46 (45%) Frame = -2 Query: 138 NSSSFLQTVDYLFPHGCLSYISWYCVICCNLSTLCFSLKSGEIAGQ 1 N+ +FL + GCL + W+ + C LC +L + + Q Sbjct: 360 NAVAFLGPLMRAAERGCLQVVEWFVNLGCRDMELCLALTAATSSSQ 405 >12_02_0188 - 15158824-15159215,15159299-15159809,15159885-15160015, 15160107-15160310,15160385-15161066,15161158-15161414, 15161491-15161631,15161731-15162136 Length = 907 Score = 26.6 bits (56), Expect = 3.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 132 SSFLQTVDYLFPHGCLSYISWY 67 S F T+D + H CLS +SW+ Sbjct: 399 SKFSGTMDGRYAHACLSSMSWW 420 >12_02_0078 + 13290432-13290924,13290998-13291201,13291290-13292024, 13292108-13292499 Length = 607 Score = 25.8 bits (54), Expect = 5.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 132 SSFLQTVDYLFPHGCLSYISWY 67 S F T + + H CLS ISW+ Sbjct: 68 SKFSGTTEGRYAHACLSSISWW 89 >12_02_0925 - 24398851-24398998,24399478-24399718,24399886-24400536, 24400625-24400828,24400902-24401583,24401678-24401934, 24402010-24402704,24403150-24403397 Length = 1041 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 132 SSFLQTVDYLFPHGCLSYISWY 67 S F T++ + H CLS +SW+ Sbjct: 531 SKFSGTLEGKYAHACLSSLSWW 552 >09_04_0256 + 16148820-16148998,16149547-16150241,16150317-16150573, 16150668-16151349,16151423-16151626,16151715-16152449, 16152533-16152698,16153253-16153400 Length = 1021 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 132 SSFLQTVDYLFPHGCLSYISWY 67 S F T++ + H CLS +SW+ Sbjct: 508 SKFSGTLEGRYAHACLSSLSWW 529 >09_04_0144 + 15071723-15071993,15072078-15072632,15072671-15072681, 15072954-15073012,15073962-15074040 Length = 324 Score = 25.4 bits (53), Expect = 7.1 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 133 FILLADCRLFIPPWLFKLYILVLCNL 56 F+ + CR IPP LF + + LC L Sbjct: 163 FVEMDTCRDIIPPELFDRWSVSLCEL 188 >08_01_0463 - 4075037-4075316,4075997-4076151,4076818-4078861, 4080757-4081589 Length = 1103 Score = 25.4 bits (53), Expect = 7.1 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 20 LFNEKQSVLKLQQITQYQDI*LKQPWGN 103 LF+E+Q + KLQ+I Q + + + WG+ Sbjct: 260 LFDERQLINKLQEILQEKSL-VSSSWGS 286 >07_03_1652 - 28409097-28409165,28409788-28409911,28410317-28410557, 28410641-28411375,28411464-28411667,28411741-28412422, 28412517-28412773,28412849-28413543,28414003-28414250 Length = 1084 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 132 SSFLQTVDYLFPHGCLSYISWY 67 S F T++ + H CLS +SW+ Sbjct: 531 SKFSGTLEGRYAHACLSSLSWW 552 >07_03_0014 - 12428713-12428860,12429340-12429580,12429664-12430398, 12430487-12430690,12430764-12431445,12431540-12431796, 12431872-12432566,12433012-12433172,12434039-12434383, 12434399-12434631,12434656-12434740 Length = 1261 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 132 SSFLQTVDYLFPHGCLSYISWY 67 S F T++ + H CLS +SW+ Sbjct: 723 SKFSGTLEGRYAHACLSSLSWW 744 >05_01_0595 + 5344721-5345249,5349183-5349264,5349813-5350507, 5350583-5350839,5350934-5351615,5351689-5351892, 5351981-5352715,5352799-5353181 Length = 1188 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 132 SSFLQTVDYLFPHGCLSYISWY 67 S F T++ + H CLS +SW+ Sbjct: 652 SKFSGTLEGRYAHACLSSLSWW 673 >03_03_0039 - 13986844-13986907,13987219-13987273,13987492-13987606, 13987652-13987774,13987962-13988015,13988352-13988411, 13988522-13988584,13988790-13988863,13989177-13989261, 13989376-13989456,13989764-13989856,13990275-13990339, 13990407-13990482,13990570-13990635,13991094-13991153, 13991233-13991322,13991755-13991817,13992502-13992625, 13993031-13993271,13993355-13993624,13993715-13994089, 13994178-13994381,13994455-13995136,13995231-13995279, 13995362-13995488,13995564-13996258,13996718-13996965 Length = 1433 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 132 SSFLQTVDYLFPHGCLSYISWY 67 S F T++ + H CLS +SW+ Sbjct: 504 SKFSGTLEGRYAHACLSSLSWW 525 >02_05_1149 + 34471730-34471790,34471975-34472056,34472605-34473299, 34473375-34473631,34473726-34474407,34474481-34474684, 34474773-34474903,34475068-34475263,34475347-34475587, 34476067-34476214 Length = 898 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 132 SSFLQTVDYLFPHGCLSYISWY 67 S F T++ + H CLS +SW+ Sbjct: 496 SKFSGTLEGRYAHACLSSLSWW 517 >02_05_1110 - 34182943-34182963,34183122-34183301,34184201-34184546, 34184794-34184846 Length = 199 Score = 25.4 bits (53), Expect = 7.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -1 Query: 124 LADCRLFIPPWLFKLYILVLCNLL*FEYTLLFIEKW 17 L C PPWL +++V NLL +F + W Sbjct: 41 LPHCHRPTPPWLPATFVVVAANLLASSRKPIFGQIW 76 >01_05_0117 - 18300157-18301106,18301149-18301543,18302592-18302681, 18303723-18303836,18303903-18304046,18316147-18316312, 18316396-18317130,18317219-18317422,18317496-18318177, 18318272-18318528,18318604-18319298,18319345-18319382, 18319847-18319928,18320018-18320112,18320443-18320526, 18320601-18320891,18321521-18321853,18321948-18322150, 18322243-18322399,18322482-18322585,18322675-18322835, 18323511-18323824,18324317-18324589,18324666-18324967, 18325459-18325549,18326140-18326190,18326700-18326768, 18326926-18327017,18327082-18327148,18328582-18328746, 18329027-18329103,18329572-18329766,18330208-18330275, 18331081-18331172,18331399-18331522,18331608-18331705, 18332384-18332997,18333620-18333626 Length = 2892 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 132 SSFLQTVDYLFPHGCLSYISWY 67 S F T++ + H CLS +SW+ Sbjct: 1864 SKFSGTLEGRYAHACLSSLSWW 1885 >10_05_0114 + 9294747-9294788,9294883-9294996,9295066-9295173, 9295774-9296145,9296584-9296652,9296754-9296825, 9297070-9297198,9297690-9297770,9298622-9298807, 9299135-9299860 Length = 632 Score = 25.0 bits (52), Expect = 9.4 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -1 Query: 133 FILLADC-RLFIPPWLFKLYILVLCNLL*FEYTLLFIEK 20 FIL+A L I WL + +L+LC L E++ I K Sbjct: 250 FILMASAVLLLIMQWLVGILVLILCLLKRGEFSGQIISK 288 >04_04_1109 + 30965143-30965312,30965406-30965586,30965669-30966100, 30966176-30966277,30966376-30966681,30966755-30966817, 30967758-30967856 Length = 450 Score = 25.0 bits (52), Expect = 9.4 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 Query: 137 TVHPSCRLSTIYSPMVV*VIYPGT 66 TVHPSC T +++ YPGT Sbjct: 60 TVHPSCLKVTTTLSLLIKQNYPGT 83 >01_01_0631 - 4752606-4752706,4754039-4755578 Length = 546 Score = 25.0 bits (52), Expect = 9.4 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 63 HSTRIYNLNNHGGINSRQSARRMNCW 140 H + N+N HGG +SR + + W Sbjct: 343 HGIKFVNVNQHGGSSSRSFSITLWSW 368 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,861,203 Number of Sequences: 37544 Number of extensions: 119316 Number of successful extensions: 277 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 270 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 276 length of database: 14,793,348 effective HSP length: 70 effective length of database: 12,165,268 effective search space used: 291966432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -