BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10808 (620 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 23 5.9 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 7.8 AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsiv... 23 7.8 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 23.4 bits (48), Expect = 5.9 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 619 EGDL-NFEAXHAAPVGSRSARIYRASCYLWS*HAHPQILDE 500 +GD+ N A AAP GS I + LWS H LD+ Sbjct: 407 KGDITNGLAIEAAPYGSSVDMIKLSGADLWSAIDHSFTLDD 447 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 7.8 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 192 VQYRGFEPYPSWHHGE 145 + Y GFEPY H G+ Sbjct: 1335 ISYYGFEPYERNHFGK 1350 >AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsive protein 2 protein. Length = 439 Score = 23.0 bits (47), Expect = 7.8 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 553 GKFELTGIPPAPRGVPQN*G 612 G +TG+PP P P N G Sbjct: 307 GDSGITGVPPLPADGPSNPG 326 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 645,784 Number of Sequences: 2352 Number of extensions: 12511 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60214320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -