BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10805 (620 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29492| Best HMM Match : Ribosomal_S3_C (HMM E-Value=1.8e-28) 197 5e-51 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_50657| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_55955| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_55460| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_53830| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_51993| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_48637| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_44589| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_37074| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_35876| Best HMM Match : Histone (HMM E-Value=5.1) 27 9.3 SB_30057| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_29024| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_23531| Best HMM Match : Histone (HMM E-Value=8.9e-09) 27 9.3 SB_21880| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_20370| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_18391| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_17374| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_13453| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_8948| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_4426| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_3841| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_59571| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_58125| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_57761| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_56157| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_55483| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_55375| Best HMM Match : Histone (HMM E-Value=9.2e-35) 27 9.3 SB_54709| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_53175| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_51431| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_49908| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_48866| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_48698| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_47677| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_45363| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_43396| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_42599| Best HMM Match : DUF536 (HMM E-Value=7.2) 27 9.3 SB_38339| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_37823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_33151| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_25703| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_20764| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 27 9.3 SB_19243| Best HMM Match : Histone (HMM E-Value=1e-16) 27 9.3 SB_19242| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_18626| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_17756| Best HMM Match : Histone (HMM E-Value=8.5e-41) 27 9.3 SB_17103| Best HMM Match : Histone (HMM E-Value=0.65) 27 9.3 SB_15200| Best HMM Match : Histone (HMM E-Value=0.22) 27 9.3 SB_14746| Best HMM Match : Histone (HMM E-Value=4.4e-32) 27 9.3 SB_13396| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_7960| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_7640| Best HMM Match : Histone (HMM E-Value=4.80001e-41) 27 9.3 SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39) 27 9.3 SB_4579| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 27 9.3 SB_512| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 >SB_29492| Best HMM Match : Ribosomal_S3_C (HMM E-Value=1.8e-28) Length = 240 Score = 197 bits (481), Expect = 5e-51 Identities = 95/122 (77%), Positives = 101/122 (82%) Frame = +3 Query: 255 ELYAEKVATRGLCAIAQAESLRYKLIGGLAVRRACYGVLRFIMESGARGCEVVVSGKLRG 434 ELYAEKVATRGLCAIAQ ESLRYKLIGGLAVRRACYGVLRFIMESGA+GCEVVVSGKLRG Sbjct: 85 ELYAEKVATRGLCAIAQCESLRYKLIGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRG 144 Query: 435 QRAKSMKFVDGLMIHSGDPCNDYVKLLPDMCFSDKEY*AIKVKIMLPWDQQGKNGPKKPQ 614 QRAKSMKFVDGLM+H+G+P YV + + IKVKIMLPWD GK GPKKP Sbjct: 145 QRAKSMKFVDGLMVHAGEPTTHYVDTAVRHVYLRQGVLGIKVKIMLPWDPTGKTGPKKPL 204 Query: 615 PD 620 PD Sbjct: 205 PD 206 Score = 146 bits (355), Expect = 1e-35 Identities = 72/80 (90%), Positives = 76/80 (95%) Frame = +1 Query: 16 ISKKRKFVGDGVFKAELNEFLTRELAEDGYSGVEVRVTPIRSEIIIMATRTQSVLGEKGR 195 ISKKRKFV DG+FKAELNEFLTRELAEDGYSGVEVRVTPIR+EIII+ATRTQ+VLGEKGR Sbjct: 5 ISKKRKFVADGLFKAELNEFLTRELAEDGYSGVEVRVTPIRTEIIILATRTQNVLGEKGR 64 Query: 196 RIRELTSVVQKRFNIPEQSV 255 RIRELTSVVQKRF PE SV Sbjct: 65 RIRELTSVVQKRFGFPEGSV 84 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = +1 Query: 82 RELAEDGYSGVEVRVTPIRSEIIIMATRTQSVLGEKG-RRIRELTSVVQKRFNIPEQSVN 258 R+ AE+ ++ I SE+++MA R EK IR V + +N ++ ++ Sbjct: 2588 RDEAEEKSIEADIEKNLIESEVVVMALRNSIKTTEKSLDLIRPEAKVTEHEYNNCQRDID 2647 Query: 259 CM 264 CM Sbjct: 2648 CM 2649 >SB_50657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 53 SRQNSMSSSLGSWPRTATPAWKCGSLPSARRSLLWPPGH-RVCSERKDAESVSSLP*Y 223 +R+ ++ +L + P T +CG + +AR L+ P H R + V SLP Y Sbjct: 272 TRKMMLTRALSTTPSTTPELRRCGGVLTAREGLIMSPNHPRPYPSDTHCKWVISLPSY 329 >SB_55955| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_55460| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_53830| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_51993| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_48637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_44589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_37074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_35876| Best HMM Match : Histone (HMM E-Value=5.1) Length = 157 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_30057| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 260 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 158 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 192 >SB_29024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 998 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 246 LWNVESLLYYGSELTDSASFLSEHTLCPGGHNNDLRADGSDPH 118 LWN++ + + F + H+ C GG N D A GS+ H Sbjct: 186 LWNIKDRVLERKYQGVTQGFYTIHS-CFGGVNQDFLASGSEDH 227 >SB_23531| Best HMM Match : Histone (HMM E-Value=8.9e-09) Length = 110 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_21880| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_20370| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_18391| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_17374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_13453| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_8948| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_4426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_3841| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_59571| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_58125| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_57761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_56157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_55483| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_55375| Best HMM Match : Histone (HMM E-Value=9.2e-35) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_54709| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_53175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_51431| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_49908| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_48866| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 205 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 103 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 137 >SB_48698| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_47677| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_45363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_43396| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 131 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 29 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 63 >SB_42599| Best HMM Match : DUF536 (HMM E-Value=7.2) Length = 120 Score = 27.5 bits (58), Expect = 9.3 Identities = 18/63 (28%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Frame = +1 Query: 61 ELNEFLTRELAE-DGYSGVEVRVTPIRSEIIIMATRTQSVLGEKGRRIRELTSVVQKRFN 237 E+ E + + +AE +G SG EV+ ++ + ++ +TQ E ++ +EL + +KR N Sbjct: 20 EVIEVVNKLIAEGEGESGNEVKENKVKKKPSVIK-QTQ----EDEKKTKELEELKEKRIN 74 Query: 238 IPE 246 +P+ Sbjct: 75 LPQ 77 >SB_38339| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_37823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 423 Score = 27.5 bits (58), Expect = 9.3 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 288 GHE*PPFQHTIHRLLWNVESLLYYGS 211 GH ++H RL WN+E L +Y S Sbjct: 263 GHHVGDWEHVTIRLNWNMEPLQFYAS 288 >SB_33151| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_25703| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_20764| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 68 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_19243| Best HMM Match : Histone (HMM E-Value=1e-16) Length = 117 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_19242| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_18626| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_17756| Best HMM Match : Histone (HMM E-Value=8.5e-41) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_17103| Best HMM Match : Histone (HMM E-Value=0.65) Length = 97 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_15200| Best HMM Match : Histone (HMM E-Value=0.22) Length = 97 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_14746| Best HMM Match : Histone (HMM E-Value=4.4e-32) Length = 162 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_13396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 493 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_7960| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_7640| Best HMM Match : Histone (HMM E-Value=4.80001e-41) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39) Length = 370 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_4579| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 >SB_512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 272 GGYSWPLRYRPGRISKIQAYRRSRCTSCLLWCSPF 376 GG P RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,068,179 Number of Sequences: 59808 Number of extensions: 374018 Number of successful extensions: 1059 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 970 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1055 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -