BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10804 (706 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY601760-1|AAT35808.1| 528|Homo sapiens Na+/Ca2+ K+ independent... 31 5.3 >AY601760-1|AAT35808.1| 528|Homo sapiens Na+/Ca2+ K+ independent exchanger short splice isoform protein. Length = 528 Score = 30.7 bits (66), Expect = 5.3 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +2 Query: 239 VSNGASSTYFLINGSNMYAKLSYTSPSADRHCRSISLITLFGYYG-YIFFTTDSSICT 409 +S+ + FL G+ S +D H ++L LFGY G Y+F+ +CT Sbjct: 135 LSHNVAGVTFLAFGNGAPDIFSALVAFSDPHTAGLALGALFGYLGLYVFYVVTVILCT 192 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,340,470 Number of Sequences: 237096 Number of extensions: 2193224 Number of successful extensions: 3385 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3293 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3385 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8175213644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -