BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10804 (706 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 24 1.6 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 24 1.6 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 22 6.5 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 6.5 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 22 6.5 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 22 6.5 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 21 8.6 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 332 CRSISLITLFGYYGYIFFTTDSSI 403 C S++ + GY YI+FTT +I Sbjct: 535 CGLSSMLCIPGYMIYIWFTTSGTI 558 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 332 CRSISLITLFGYYGYIFFTTDSSI 403 C S++ + GY YI+FTT +I Sbjct: 588 CGLSSMLCIPGYMIYIWFTTSGTI 611 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.8 bits (44), Expect = 6.5 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -2 Query: 552 ERISIYYEESDSFNETVTDWFSY 484 E + +Y+ DSF+ ++ F Y Sbjct: 211 EGLIVYHNSDDSFHRLTSNTFDY 233 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.8 bits (44), Expect = 6.5 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +1 Query: 448 NFRLVYGDCLPAITEPICYCFIETIRFLIIYAN 546 N ++ D AIT+P+ Y T R +I+Y + Sbjct: 131 NLCMISVDRFCAITKPLKYGVKRTPRRMIVYVS 163 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 6.5 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -2 Query: 552 ERISIYYEESDSFNETVTDWFSY 484 E + +Y+ DSF+ ++ F Y Sbjct: 211 EGLIVYHNSDDSFHRLTSNTFDY 233 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 6.5 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -2 Query: 552 ERISIYYEESDSFNETVTDWFSY 484 E + +Y+ DSF+ ++ F Y Sbjct: 211 EGLIVYHNSDDSFHRLTSNTFDY 233 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = -2 Query: 213 GFLGMDKT*RSKISVTQQINSYFDNSKINNLT 118 G + ++K + + TQ+IN F ++ N+T Sbjct: 74 GLMCVEKVSTTIVPTTQEINKPFKRLELFNIT 105 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,556 Number of Sequences: 438 Number of extensions: 4670 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -