BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10803 (730 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0410 - 23223701-23223714,23223863-23225159,23225314-232262... 29 3.8 07_03_0466 + 18474929-18475315,18476035-18476298,18476717-184767... 28 8.7 >11_06_0410 - 23223701-23223714,23223863-23225159,23225314-23226225, 23226952-23227023,23227323-23227471,23227879-23227912 Length = 825 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 5/44 (11%) Frame = -1 Query: 169 LLFLVYINL-----LWNFFFFYLKSVFVKACLFTIILKYILADS 53 LL + Y+NL LW F F++ + V C + I++++I + S Sbjct: 214 LLVVAYMNLTRGSKLWRFPFWFFWGLLVLQCFYKILVRHIASKS 257 >07_03_0466 + 18474929-18475315,18476035-18476298,18476717-18476755, 18476756-18476878,18477118-18477240 Length = 311 Score = 27.9 bits (59), Expect = 8.7 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = +2 Query: 209 VIHLFIAHVLNANLRLFGFLMDTIIRTGLN*NGTTRQASVSNKKESSKSIHPVK 370 V+ LF+ V+ +L+ L+D R L+ G R+ V + S +IH V+ Sbjct: 223 VMTLFMLQVIYRDLKSSNVLLDEEFRPKLSDFGLAREGPVDGQTHVSTAIHAVQ 276 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,987,258 Number of Sequences: 37544 Number of extensions: 254502 Number of successful extensions: 386 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 386 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -