BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10803 (730 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g27370.1 68417.m03929 myosin family protein contains Pfam pro... 33 0.19 At4g20470.1 68417.m02986 hypothetical protein 28 7.3 >At4g27370.1 68417.m03929 myosin family protein contains Pfam profiles: PF00063 myosin head (motor domain), PF00612 IQ calmodulin-binding motif Length = 1126 Score = 33.1 bits (72), Expect = 0.19 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Frame = +2 Query: 341 ESSKSIHPVKSYEVTNIKKHIVELRTLKS-VKK*KDTYKL-IRSRKLQI 481 E KS+ VKS ++N K+H ELR LKS +K K YK +R K ++ Sbjct: 1060 EDPKSLVEVKSDSISNRKQHAEELRRLKSRFEKWKKDYKTRLRETKARV 1108 >At4g20470.1 68417.m02986 hypothetical protein Length = 140 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = -1 Query: 205 ITQYHANRFIR*LLFLVYINLLWNFFFFYLKSVFVKACLFTIILKYIL 62 +T+ + F+ FL+ +LL FFFF S+F + F+ K +L Sbjct: 40 VTRSRSCGFVLHCTFLLLSSLLTFFFFFRFSSIFSLSLFFSFSQKSLL 87 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,387,798 Number of Sequences: 28952 Number of extensions: 245082 Number of successful extensions: 431 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 431 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -