BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10798 (335 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 24 0.57 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 24 0.57 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 2.3 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 2.3 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 2.3 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 2.3 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 2.3 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 2.3 AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding prote... 21 3.0 AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding prote... 21 3.0 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 4.0 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 5.3 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 5.3 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 20 7.0 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 20 7.0 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 20 7.0 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 20 9.2 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 20 9.2 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 23.8 bits (49), Expect = 0.57 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 25 LNKAGKFPGLLSHQE 69 LNK GK P L++H+E Sbjct: 573 LNKIGKNPNLVAHRE 587 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 23.8 bits (49), Expect = 0.57 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 25 LNKAGKFPGLLSHQE 69 LNK GK P L++H+E Sbjct: 541 LNKIGKNPNLVAHRE 555 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 2.3 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +2 Query: 197 FPSTSLCHCSRNTGRMSDHSYEINDG 274 F TS CH R D + NDG Sbjct: 224 FQRTSSCHSRYEDSRHEDRNSYRNDG 249 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 2.3 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +2 Query: 197 FPSTSLCHCSRNTGRMSDHSYEINDG 274 F TS CH R D + NDG Sbjct: 224 FQRTSSCHSRYEDSRHEDRNSYRNDG 249 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 2.3 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +2 Query: 197 FPSTSLCHCSRNTGRMSDHSYEINDG 274 F TS CH R D + NDG Sbjct: 224 FQRTSSCHSRYEDSRHEDRNSYRNDG 249 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 2.3 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +2 Query: 197 FPSTSLCHCSRNTGRMSDHSYEINDG 274 F TS CH R D + NDG Sbjct: 224 FQRTSSCHSRYEDSRHEDRNSYRNDG 249 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.8 bits (44), Expect = 2.3 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +2 Query: 197 FPSTSLCHCSRNTGRMSDHSYEINDG 274 F TS CH R D + NDG Sbjct: 224 FQRTSSCHSRYEDSRHEDRNSYRNDG 249 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.8 bits (44), Expect = 2.3 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +2 Query: 197 FPSTSLCHCSRNTGRMSDHSYEINDG 274 F TS CH R D + NDG Sbjct: 224 FQRTSSCHSRYEDSRHEDRNSYRNDG 249 >AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 21.4 bits (43), Expect = 3.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 151 GHVDMTPDELAQNVHLSINFLVS 219 G ++TPD+ ++VH I VS Sbjct: 79 GTRELTPDDFTEDVHEIIEQCVS 101 >AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 21.4 bits (43), Expect = 3.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 151 GHVDMTPDELAQNVHLSINFLVS 219 G ++TPD+ ++VH I VS Sbjct: 79 GTRELTPDDFTEDVHEIIEQCVS 101 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 4.0 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +2 Query: 197 FPSTSLCHCSRNTGRMSDHSYEINDG 274 F TS CH R D + NDG Sbjct: 224 FQRTSSCHSRYEDSRHEDGNSYRNDG 249 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 20.6 bits (41), Expect = 5.3 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +3 Query: 9 FVGSRFEQSW*IPWSSLPP 65 + G+RF + IP LPP Sbjct: 432 YYGNRFSGEYEIPAHGLPP 450 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 20.6 bits (41), Expect = 5.3 Identities = 5/18 (27%), Positives = 10/18 (55%) Frame = +1 Query: 205 NFLVSLLKKHWQNVRSFI 258 N+L + ++W R F+ Sbjct: 338 NYLTKFVSEYWMETRGFL 355 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 20.2 bits (40), Expect = 7.0 Identities = 8/30 (26%), Positives = 14/30 (46%) Frame = -1 Query: 140 ERHNTFFIWNLMVPLTSSIFCVMDSWWERR 51 +RH +F+ + VP + S+W R Sbjct: 241 QRHTGYFLIQVYVPCVLIVVLSWVSFWIHR 270 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.2 bits (40), Expect = 7.0 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +2 Query: 197 FPSTSLCHCSRNTGRMSDHSYEINDG 274 F TS CH R D + NDG Sbjct: 224 FQRTSSCHSRYEDLRHEDRNSYRNDG 249 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 20.2 bits (40), Expect = 7.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 13 LGPGLNKAGKF 45 L PG NK GKF Sbjct: 238 LEPGTNKNGKF 248 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 19.8 bits (39), Expect = 9.2 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = -3 Query: 96 DFINLLRHGLL 64 +F+ LL+HG+L Sbjct: 79 EFMQLLKHGML 89 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 19.8 bits (39), Expect = 9.2 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = -3 Query: 96 DFINLLRHGLL 64 +F+ LL+HG+L Sbjct: 79 EFMQLLKHGML 89 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,520 Number of Sequences: 438 Number of extensions: 2163 Number of successful extensions: 18 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7591023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -