BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10795 (315 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 26 0.11 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 24 0.43 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 2.3 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 21 4.0 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 25.8 bits (54), Expect = 0.11 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = -2 Query: 215 EPMLVIRSRTLMPSKALANRPGQYGSTSTAAAFKMVEIFSPVTATSSSTRMRAE*T 48 +P VI + T PS L+NR G+ A+ P T+T++ T + + T Sbjct: 123 KPSGVISTNTSPPSPILSNRFGENEEADAASNVISSTPLPPTTSTTTRTTLTTKFT 178 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 23.8 bits (49), Expect = 0.43 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 8/62 (12%) Frame = +1 Query: 13 KLKMVSKAELACVYSALILVDD--------DVAVTGEKISTILKAAAVDVEPYWPGLFAK 168 ++KM K EL C+ + ++ D +V + EKI +L+ P PG FAK Sbjct: 305 EMKM-DKTELGCLRAIILYNPDVRGIKSVQEVEMLREKIYGVLEEYTRTTHPNEPGRFAK 363 Query: 169 AL 174 L Sbjct: 364 LL 365 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 2.3 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -1 Query: 192 TDIDAFQGFGEQTWPI 145 TD+D F+G WP+ Sbjct: 515 TDLDDFKGVCGMKWPL 530 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 20.6 bits (41), Expect = 4.0 Identities = 11/44 (25%), Positives = 19/44 (43%) Frame = +1 Query: 73 DDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLIT 204 + D+A+TG+ +I + + Y+ L L I L T Sbjct: 373 NSDIAITGKNFFSITRGLILSFVDYFVFLLCSILVNIAFIKLAT 416 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,737 Number of Sequences: 336 Number of extensions: 1367 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 5836655 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -