BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10795 (315 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0113 + 897970-898038,898148-898271,898811-898896,898996-89... 81 1e-16 01_06_1411 + 37127098-37128279 29 1.0 06_03_1078 + 27418886-27419215 28 1.8 05_03_0235 - 10747649-10748118,10748226-10748314,10748477-107485... 27 3.1 03_02_0805 + 11382631-11384747,11385012-11385095,11385181-11385376 27 4.1 01_06_1007 - 33733500-33733604,33733837-33733917,33734191-337342... 27 4.1 07_03_1291 + 25545749-25546262,25546989-25547669,25547693-255477... 26 5.4 07_03_0035 - 12677942-12678568 26 5.4 09_02_0048 - 3532663-3533475,3534086-3534589,3534715-3535740,353... 26 7.1 07_03_1604 - 28089032-28089079,28089161-28089371,28089484-280898... 26 7.1 06_01_0025 - 244068-244177,244279-244333,244500-244527,244621-24... 26 7.1 03_05_0033 - 20048994-20050049,20050131-20050210,20050324-20050435 26 7.1 09_04_0318 - 16620177-16620582,16620686-16620765,16620873-166212... 25 9.4 08_01_0977 - 9839362-9839524,9839656-9839744 25 9.4 07_03_0587 + 19708841-19709282,19709693-19709883,19710429-197105... 25 9.4 07_03_0537 - 19218461-19218982,19219482-19219868,19219993-192201... 25 9.4 05_01_0555 + 4867494-4867577,4868987-4869607 25 9.4 04_04_0223 - 23723055-23723223,23723316-23723424,23723588-237236... 25 9.4 02_05_0996 - 33380363-33380597,33380767-33380851,33381206-333815... 25 9.4 01_01_0743 - 5763654-5766902 25 9.4 >08_01_0113 + 897970-898038,898148-898271,898811-898896,898996-899049 Length = 110 Score = 81.4 bits (192), Expect = 1e-16 Identities = 37/65 (56%), Positives = 50/65 (76%) Frame = +1 Query: 25 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLIT 204 +S +E+AC +ALIL DD + +T EKI+T++KAA + VE YWPGLFAK LE +V DLI Sbjct: 1 MSSSEVACTLAALILHDDGIPITSEKIATLVKAANIKVEAYWPGLFAKLLEHRSVDDLIL 60 Query: 205 NIGSG 219 ++GSG Sbjct: 61 SVGSG 65 >01_06_1411 + 37127098-37128279 Length = 393 Score = 28.7 bits (61), Expect = 1.0 Identities = 21/58 (36%), Positives = 25/58 (43%) Frame = -3 Query: 253 LALHQRPEQHPLQSRCW*SGHGH*CLPRLWRTDLANMALHLQPPLSRWWKFSHQLRQH 80 L LH R Q P+ R H H L L LHL P L R + H+LR+H Sbjct: 94 LHLHLRHHQFPVYRRGHHPDHDHDPLLH----PLPRQELHLDPSLRRALRSWHRLRRH 147 >06_03_1078 + 27418886-27419215 Length = 109 Score = 27.9 bits (59), Expect = 1.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 150 ARSVRQSLGRHQCP*PDHQHRLWSGCCSGRWW 245 +RS R G + P P H R+W+G G WW Sbjct: 29 SRSNRAPSGAFRPPDPRHPGRIWTG---GGWW 57 >05_03_0235 - 10747649-10748118,10748226-10748314,10748477-10748574, 10748934-10749046,10749107-10749200,10749557-10749589, 10749734-10749851,10750110-10750210,10751036-10751233, 10751337-10751471,10751752-10751830,10753650-10753738, 10753835-10753987,10754100-10754285 Length = 651 Score = 27.1 bits (57), Expect = 3.1 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 97 HQLRQHHHPPG*EQSKH 47 HQ R+HHHPP + H Sbjct: 562 HQRRRHHHPPAWDVEGH 578 >03_02_0805 + 11382631-11384747,11385012-11385095,11385181-11385376 Length = 798 Score = 26.6 bits (56), Expect = 4.1 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +3 Query: 105 FHHLESGGCRCRAILARSVRQSLGRHQCP*PDHQHRLWSGCCSGRW-WS 248 FHH + G C CR + ++ R + P + +WS S W WS Sbjct: 692 FHHFKDGFCSCRDYWIQVSKRPFDR-EVHHPLQANCIWSIVLSRSWVWS 739 >01_06_1007 - 33733500-33733604,33733837-33733917,33734191-33734238, 33734364-33734549,33735148-33735678,33735823-33735864, 33735945-33736065,33736200-33736281,33737169-33737227, 33738492-33738564,33738694-33738913 Length = 515 Score = 26.6 bits (56), Expect = 4.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 155 VCSPKPWKASMSVT*SPTSALEWVLLRPLV 244 VC +P SP +L WVLLRP++ Sbjct: 482 VCKLRPTALLADGVASPLRSLAWVLLRPIM 511 >07_03_1291 + 25545749-25546262,25546989-25547669,25547693-25547751, 25549152-25549242,25549330-25549743,25550191-25550243, 25550947-25551177,25551492-25551708,25551790-25551890, 25552446-25552532,25553536-25553676,25553839-25553961, 25554070-25554522,25554931-25555308,25555410-25556060, 25556264-25556368,25556482-25556707,25557204-25557241 Length = 1520 Score = 26.2 bits (55), Expect = 5.4 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -1 Query: 171 GFGEQTWPIW--LYIYSRRFQDGGNFLTSYG 85 G G+ +W +Y +S + QDG NF+ G Sbjct: 627 GAGKGLMTVWHAMYSHSSKIQDGSNFIDETG 657 >07_03_0035 - 12677942-12678568 Length = 208 Score = 26.2 bits (55), Expect = 5.4 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +2 Query: 149 GQVCSPKPWKASMSVT*SPTSALEWVLLRP 238 G V SP + A M SPT+A W LLRP Sbjct: 96 GVVASPARFGAVMLA--SPTAANRWFLLRP 123 >09_02_0048 - 3532663-3533475,3534086-3534589,3534715-3535740, 3536083-3536226,3536974-3537375,3537499-3537721, 3537830-3542368,3542480-3542599,3543005-3543038, 3543922-3544102,3544198-3544815,3545022-3551098, 3551139-3551304,3551508-3551614,3552056-3552178, 3553417-3553642 Length = 5100 Score = 25.8 bits (54), Expect = 7.1 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 145 MALHLQPPLSRWWKFSHQLRQHHHPP 68 + LH +P L W +F +QH P Sbjct: 4466 LVLHFEPYLMNWSEFDQLQKQHEENP 4491 >07_03_1604 - 28089032-28089079,28089161-28089371,28089484-28089853, 28090034-28090199 Length = 264 Score = 25.8 bits (54), Expect = 7.1 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +2 Query: 47 VFTLLSSWWMMMLP 88 +F+++SSWWM LP Sbjct: 30 LFSIISSWWMNPLP 43 >06_01_0025 - 244068-244177,244279-244333,244500-244527,244621-244691, 244829-244926,245069-245186,245573-245636,245744-245808, 245893-245928,246255-246311,246422-246691 Length = 323 Score = 25.8 bits (54), Expect = 7.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 169 LWRTDLANMALHLQPPLSRWWKFSHQLRQH 80 +W+TD H + L W F H+LRQH Sbjct: 234 VWQTDCIARVSH-EDGLVVGWIFLHELRQH 262 >03_05_0033 - 20048994-20050049,20050131-20050210,20050324-20050435 Length = 415 Score = 25.8 bits (54), Expect = 7.1 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = +1 Query: 19 KMVSKAELACVYSALILVDDDVAVTGEKIS---TILKAAAVDVEPYWPGLFAKALEGI 183 +++ +L V + + +VD + T +++ I KA V+ + PGL AKA GI Sbjct: 155 RVLEGEKLPVVTAKITMVDLPLGATEDRVCGTIDIEKALTDGVKAFEPGLLAKANRGI 212 >09_04_0318 - 16620177-16620582,16620686-16620765,16620873-16621213, 16621298-16621559 Length = 362 Score = 25.4 bits (53), Expect = 9.4 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = -2 Query: 140 STSTAAAFKMVEIFSPVTATSSSTRMRAE*THANSAFDTIFSFER 6 +TS+ AA + ATSSS A H S+F +FS R Sbjct: 302 ATSSTAAPPAAPSSGGIAATSSSAAAAAAPDHRPSSFAALFSSPR 346 >08_01_0977 - 9839362-9839524,9839656-9839744 Length = 83 Score = 25.4 bits (53), Expect = 9.4 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 64 ILVDDDVAVTGEKISTILKAAAVDVEP 144 IL + A GE ST + AAVDVEP Sbjct: 44 ILNREAAAAAGEAGSTTREEAAVDVEP 70 >07_03_0587 + 19708841-19709282,19709693-19709883,19710429-19710568, 19710955-19711380,19711540-19712685,19712805-19712934, 19713257-19713492,19713575-19713710,19713793-19713869, 19714692-19714798,19714896-19714996 Length = 1043 Score = 25.4 bits (53), Expect = 9.4 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +1 Query: 28 SKAELACVYSALILVDDDVAVTG 96 S ++ CV S+ +++DDD+ + G Sbjct: 544 SLSQCLCVRSSSVIIDDDLVIVG 566 >07_03_0537 - 19218461-19218982,19219482-19219868,19219993-19220154, 19220464-19221117,19221233-19221277,19223300-19223845, 19223930-19224307,19224642-19225313,19225373-19225456 Length = 1149 Score = 25.4 bits (53), Expect = 9.4 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -2 Query: 152 GQYGSTSTAAAFKMVEIFSPVTATSSS 72 G +G T+ AAA ++F+P T +S Sbjct: 942 GDHGHTADAAAAAAADVFTPATMARAS 968 >05_01_0555 + 4867494-4867577,4868987-4869607 Length = 234 Score = 25.4 bits (53), Expect = 9.4 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -2 Query: 197 RSRTLMPSKALANRPGQYGSTSTAAA--FKMVEIFSPVTATSSS 72 R +MP+ A+ R +G TST A F ++ ++ PVT +S S Sbjct: 175 RVAAVMPAPAM--RAAVWGMTSTVAVAGFYLLFVYRPVTISSYS 216 >04_04_0223 - 23723055-23723223,23723316-23723424,23723588-23723690, 23723781-23723812,23724024-23724241,23724322-23724437, 23725055-23725310,23725719-23725806,23725928-23726005, 23726199-23726274,23726525-23726583,23727715-23728066 Length = 551 Score = 25.4 bits (53), Expect = 9.4 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 165 GEQTWPIWLYIYSRRFQDGGNFL-TSYGNIIIHQDESRVN 49 G Q WLY+Y + F+D ++ +YGN ++ E+ V+ Sbjct: 423 GPQAASPWLYVYPQGFRDLLLYVKENYGNPTVYITENGVD 462 >02_05_0996 - 33380363-33380597,33380767-33380851,33381206-33381557, 33381690-33382340 Length = 440 Score = 25.4 bits (53), Expect = 9.4 Identities = 9/41 (21%), Positives = 21/41 (51%) Frame = -3 Query: 124 PLSRWWKFSHQLRQHHHPPG*EQSKHMLIQLLTPFLVLNVQ 2 P+ +WWK +++R+ P + H ++ F+ +N + Sbjct: 214 PVKKWWKERNEVREGGTPRSPAKLSHPIMSRAGEFVRMNAK 254 >01_01_0743 - 5763654-5766902 Length = 1082 Score = 25.4 bits (53), Expect = 9.4 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 105 FHHLESGGCRCR 140 FHH E G C CR Sbjct: 1068 FHHFEEGRCSCR 1079 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,213,941 Number of Sequences: 37544 Number of extensions: 173610 Number of successful extensions: 466 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 464 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 386885760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -