BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10795 (315 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41974| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 3e-21 SB_43135| Best HMM Match : CMAS (HMM E-Value=0) 36 0.005 SB_58926| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_51986| Best HMM Match : HLH (HMM E-Value=0.15) 27 3.2 SB_86| Best HMM Match : PGK (HMM E-Value=0) 27 4.2 SB_33643| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.4 SB_32583| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.8 SB_2072| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.8 SB_5878| Best HMM Match : Tyrosinase (HMM E-Value=0.33) 25 9.8 >SB_41974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 97.1 bits (231), Expect = 3e-21 Identities = 43/65 (66%), Positives = 55/65 (84%) Frame = +1 Query: 22 MVSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLI 201 M S +ELACVYSALIL DDDVA+T +KI T++KAA ++VEP+WPGLFAKAL+G N+ DLI Sbjct: 1 MASTSELACVYSALILHDDDVAITADKIETLVKAAKINVEPFWPGLFAKALQGHNIADLI 60 Query: 202 TNIGS 216 + G+ Sbjct: 61 LSAGA 65 >SB_43135| Best HMM Match : CMAS (HMM E-Value=0) Length = 254 Score = 36.3 bits (80), Expect = 0.005 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = -1 Query: 201 DQVTDIDAFQGFGEQTWPIWLYIYSRRFQDGGNFLTSYGNIIIHQDESR 55 DQ+ I+ F+ G++ WP + + S R + GG+ + II DESR Sbjct: 102 DQIVSIEMFEAVGQENWPTYFQMLSERLKQGGSAVLQ----IICIDESR 146 >SB_58926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2371 Score = 27.1 bits (57), Expect = 3.2 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -1 Query: 210 DVGDQVTDIDAFQGFGEQTWPIWLYIYSRRFQDGGNFLTSY 88 D+G +VT + G T W+ +YS D G+F T Y Sbjct: 2100 DLG-RVTRVTGIATQGSPTGDKWVKLYSVEQSDDGHFFTEY 2139 >SB_51986| Best HMM Match : HLH (HMM E-Value=0.15) Length = 2110 Score = 27.1 bits (57), Expect = 3.2 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = -2 Query: 206 LVIRSRTLMPSKA-LANRPGQYGSTSTAAAFKMVEIFSPVTATSSSTRMRAE*TH 45 L++ S + P ++ LA PGQ G+T+T F+ PV S+ + TH Sbjct: 1763 LIVPSPAIAPVQSQLATTPGQVGNTNT--LFRPASTMVPVQPAVSNETLHPAVTH 1815 >SB_86| Best HMM Match : PGK (HMM E-Value=0) Length = 445 Score = 26.6 bits (56), Expect = 4.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 127 PPLSRWWKFSHQLRQHHH 74 PP RWW++ H LRQ H Sbjct: 394 PP--RWWRYRHVLRQMGH 409 >SB_33643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 25.8 bits (54), Expect = 7.4 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +1 Query: 16 LKMVSKAELACVYSALILV 72 L+M KAE+A V+SAL+L+ Sbjct: 179 LRMEQKAEMALVFSALLLL 197 >SB_32583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 526 Score = 25.4 bits (53), Expect = 9.8 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -3 Query: 136 HLQPPLSRWWKFSHQLRQHHHPP 68 H PP S F H L +HH PP Sbjct: 62 HPPPPASS--SFPHSLHRHHPPP 82 >SB_2072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 390 Score = 25.4 bits (53), Expect = 9.8 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 169 LWRTDLANMALHLQPPLSRWWKFSHQ 92 LW TDL + + QPP R W +HQ Sbjct: 116 LWHTDLLS-SRQRQPPPERNWYQAHQ 140 >SB_5878| Best HMM Match : Tyrosinase (HMM E-Value=0.33) Length = 292 Score = 25.4 bits (53), Expect = 9.8 Identities = 20/61 (32%), Positives = 23/61 (37%), Gaps = 3/61 (4%) Frame = -3 Query: 247 LHQRPEQHPLQSRCW*SGHGH*CLPRLWRTDLANMAL---HLQPPLSRWWKFSHQLRQHH 77 LH P + W G G L R + L N LQ P R+ F QLR H Sbjct: 147 LHMHVLDGPFREGSWTFGKGGKVLTRNFSGVLPNKVTVQRALQLPHKRFTDFEKQLRIFH 206 Query: 76 H 74 H Sbjct: 207 H 207 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,679,213 Number of Sequences: 59808 Number of extensions: 162605 Number of successful extensions: 366 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 326 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 366 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 400488992 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -