SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV10795
         (315 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.    23   1.2  
AF134821-1|AAD40236.1|  226|Apis mellifera hexamerin protein.          21   2.7  
DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.    20   6.2  
AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor typ...    20   8.1  

>AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.
          Length = 996

 Score = 22.6 bits (46), Expect = 1.2
 Identities = 12/40 (30%), Positives = 17/40 (42%)
 Frame = +3

Query: 111 HLESGGCRCRAILARSVRQSLGRHQCP*PDHQHRLWSGCC 230
           +L SGGC C+      V +     +CP    +H   S  C
Sbjct: 241 YLPSGGCHCKPGYQADVEKQ-ECTECPIGKFKHEAGSHSC 279


>AF134821-1|AAD40236.1|  226|Apis mellifera hexamerin protein.
          Length = 226

 Score = 21.4 bits (43), Expect = 2.7
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = +3

Query: 210 RLWSGCCSGRWWS 248
           R+ + CC+  WWS
Sbjct: 195 RVPATCCTTXWWS 207


>DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.
          Length = 471

 Score = 20.2 bits (40), Expect = 6.2
 Identities = 8/21 (38%), Positives = 12/21 (57%)
 Frame = +1

Query: 145 YWPGLFAKALEGINVRDLITN 207
           +WP   + ALEG + +  I N
Sbjct: 223 FWPSFNSAALEGDDQQRAIIN 243


>AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor type
           D2 protein.
          Length = 456

 Score = 19.8 bits (39), Expect = 8.1
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +3

Query: 213 LWSGCCSGRWW 245
           LWSG CS   W
Sbjct: 356 LWSGFCSQCIW 366


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 73,712
Number of Sequences: 438
Number of extensions: 1436
Number of successful extensions: 7
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 50
effective length of database: 124,443
effective search space used:  6719922
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)

- SilkBase 1999-2023 -