BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10785 (754 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 4.6 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 4.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 4.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 4.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 4.6 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 21 8.0 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.2 bits (45), Expect = 4.6 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = -1 Query: 568 EVSGLGRIQRSKCKSSDPLLTPLFKSR*HIVVHVSLDVSL 449 +V+ G+I+ KCK D + + H VH+ D L Sbjct: 192 KVNSHGKIKTFKCKQCDFVAITKLEQWNHSKVHIREDKRL 231 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/35 (25%), Positives = 18/35 (51%) Frame = -3 Query: 248 FFDILLIPLGIKKIFHIFFSIRK*FVLNKADRCCS 144 FF ++L+ + +FH F +I + + CC+ Sbjct: 1333 FFALILVIQFVAMLFHRFGTIAHILASTELNLCCT 1367 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/35 (25%), Positives = 18/35 (51%) Frame = -3 Query: 248 FFDILLIPLGIKKIFHIFFSIRK*FVLNKADRCCS 144 FF ++L+ + +FH F +I + + CC+ Sbjct: 1333 FFALILVIQFVAMLFHRFGTIAHILASTELNLCCT 1367 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/35 (25%), Positives = 18/35 (51%) Frame = -3 Query: 248 FFDILLIPLGIKKIFHIFFSIRK*FVLNKADRCCS 144 FF ++L+ + +FH F +I + + CC+ Sbjct: 1333 FFALILVIQFVAMLFHRFGTIAHILASTELNLCCT 1367 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/35 (25%), Positives = 18/35 (51%) Frame = -3 Query: 248 FFDILLIPLGIKKIFHIFFSIRK*FVLNKADRCCS 144 FF ++L+ + +FH F +I + + CC+ Sbjct: 1333 FFALILVIQFVAMLFHRFGTIAHILASTELNLCCT 1367 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.4 bits (43), Expect = 8.0 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = +3 Query: 588 WGPTSFHRW 614 WG T +H W Sbjct: 494 WGTTEYHNW 502 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,470 Number of Sequences: 336 Number of extensions: 3702 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -