BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10785 (754 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56823| Best HMM Match : Rhabdo_NV (HMM E-Value=7.4) 66 3e-11 SB_39750| Best HMM Match : Borrelia_orfA (HMM E-Value=1.1) 32 0.57 SB_10836| Best HMM Match : Fork_head (HMM E-Value=0) 31 1.0 SB_33144| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_42805| Best HMM Match : Aminotran_5 (HMM E-Value=8.7e-25) 29 4.1 SB_32293| Best HMM Match : BRCA2 (HMM E-Value=0) 29 5.4 SB_20037| Best HMM Match : 7tm_1 (HMM E-Value=3.09687e-43) 29 5.4 SB_27487| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 SB_59693| Best HMM Match : Phage_integr_N (HMM E-Value=2.3) 28 9.4 SB_40264| Best HMM Match : DUF667 (HMM E-Value=0) 28 9.4 >SB_56823| Best HMM Match : Rhabdo_NV (HMM E-Value=7.4) Length = 157 Score = 66.1 bits (154), Expect = 3e-11 Identities = 29/62 (46%), Positives = 39/62 (62%) Frame = +2 Query: 323 EDASKEDQIEGLVKNVKWQMSSDRKVAPLKQLQGLIWKKGYDKGDIKGHVYDDVLPALEQ 502 E A +E L+ + M DRK LK LQG+IW++GY GD GH+Y DVLP+LE+ Sbjct: 14 EIAQPAASVEQLIATLFAFMDEDRKSTALKALQGIIWREGYVNGDFTGHLYPDVLPSLEK 73 Query: 503 WR 508 W+ Sbjct: 74 WK 75 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = +1 Query: 514 EGQKIYIYSSGSVQAQKLLFGQS 582 +G +Y+YSSGSV AQKLLFG S Sbjct: 77 QGIDLYVYSSGSVAAQKLLFGYS 99 >SB_39750| Best HMM Match : Borrelia_orfA (HMM E-Value=1.1) Length = 810 Score = 31.9 bits (69), Expect = 0.57 Identities = 30/116 (25%), Positives = 45/116 (38%) Frame = +2 Query: 272 AIEDQEKSVEGLVTIPGEDASKEDQIEGLVKNVKWQMSSDRKVAPLKQLQGLIWKKGYDK 451 AIE K E + SKED+ + V+ + Q+ + ++ L L + W G D Sbjct: 23 AIELARKLEEEKKKAVSDKESKEDK-DSFVEKLAMQVVKNLQLMELNSLS-MYWNTGDDI 80 Query: 452 GDIKGHVYDDVLPALEQWRQ*RVRRFTFTPLDPSKPRNFFLVSHLLGTYFLSSMAI 619 G LP E+W T SKP F H +G Y++ S + Sbjct: 81 GK---------LPTKEEWPTIAKEGIARTMKGFSKPEGFKYGKHCIGLYYMDSSIV 127 >SB_10836| Best HMM Match : Fork_head (HMM E-Value=0) Length = 458 Score = 31.1 bits (67), Expect = 1.0 Identities = 29/88 (32%), Positives = 46/88 (52%), Gaps = 5/88 (5%) Frame = +1 Query: 376 ADVVRP*SCPPEATPGAYLEKRL**GRHQGTRVRRCATGS*TMA---SVEGQKIYIYSS- 543 A++VR SCPP AT L KR + + R +GS TM +++ +KIY S+ Sbjct: 274 AEIVRCQSCPPSATEQDSLVKR---AKEYFYKHRGSFSGSPTMVKDFAIKRRKIYGLSAS 330 Query: 544 -GSVQAQKLLFGQSSAGDLLPFIDGHFD 624 G +++ KL +S + D +DG F+ Sbjct: 331 MGRIESPKLKNRKSISPD--SSLDGEFE 356 >SB_33144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 563 Score = 29.5 bits (63), Expect = 3.1 Identities = 16/49 (32%), Positives = 30/49 (61%) Frame = +2 Query: 302 GLVTIPGEDASKEDQIEGLVKNVKWQMSSDRKVAPLKQLQGLIWKKGYD 448 G + PGED +K+D I+ L + ++ + S R++ +L+GL++ K D Sbjct: 201 GHLAPPGEDKTKQDLIQNLGR-LRQRRRSIREIQNRDELEGLMYVKQGD 248 >SB_42805| Best HMM Match : Aminotran_5 (HMM E-Value=8.7e-25) Length = 357 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +3 Query: 135 IEGTTTSISFVKDKLFPYAE--ENVKDFLDAQWDEEDVKEAV 254 I G + V D L+ Y E ENV+D+L+A E+ KE + Sbjct: 214 IAGLGQAAQLVVDHLYEYQEHMENVRDYLEASLTEKFGKECI 255 >SB_32293| Best HMM Match : BRCA2 (HMM E-Value=0) Length = 1649 Score = 28.7 bits (61), Expect = 5.4 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +3 Query: 393 VKLPP*SNSRGLSGKKVMIRETSRDTCTTMCYRL 494 VK PP S + SGKKV I E S T M RL Sbjct: 1025 VKKPPFSGFQTASGKKVEISEESLHTARDMLRRL 1058 >SB_20037| Best HMM Match : 7tm_1 (HMM E-Value=3.09687e-43) Length = 453 Score = 28.7 bits (61), Expect = 5.4 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -1 Query: 118 LLFLTISPITVFSFAISTDPHQLCRNYF-YVFQNLFD*NS 2 L FL SP VFSF + P LC +F + Q L NS Sbjct: 253 LFFLCWSPTVVFSFLVLFGPPGLCMKHFRFTSQFLVQSNS 292 >SB_27487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 555 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/63 (20%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = -3 Query: 254 HCFFDILLIPLGI-KKIFHIFFSIRK*FVLNKADRCCSSFNIKKQNFAFLNNIADYSILF 78 HC ++ + G+ + +F+ S+R N+A+R C F + A ++ + + Sbjct: 285 HCGTELGFVQHGVFRNVFNAAASVRYVIKFNEANRLCQVFGARLATIAQVDQAWKFGLFE 344 Query: 77 CHF 69 C + Sbjct: 345 CRY 347 >SB_59693| Best HMM Match : Phage_integr_N (HMM E-Value=2.3) Length = 319 Score = 27.9 bits (59), Expect = 9.4 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 5/53 (9%) Frame = +2 Query: 563 NFFLVSHLLGTY--FLSS---MAISTLL*VLNRKLPVTLLLSRK*VANLRKSC 706 + FL + LL Y +L + +A STL LNR+ VTL K V+ LR SC Sbjct: 122 DLFLRTRLLERYLDYLKTDRKLASSTLAKFLNREHAVTLYRDVKVVSQLRSSC 174 >SB_40264| Best HMM Match : DUF667 (HMM E-Value=0) Length = 2074 Score = 27.9 bits (59), Expect = 9.4 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = +3 Query: 57 CGSVEMAKENTVIGDIVKKSKVLLLDIEGTTTSISFVKDK 176 CG+ AK+ I D KS V +L+ E TTT +S KD+ Sbjct: 29 CGNASTAKK---IFDRDVKSYVFILEGESTTTKMSIPKDE 65 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,676,095 Number of Sequences: 59808 Number of extensions: 484808 Number of successful extensions: 1126 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1059 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1126 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2046258890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -