BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10784 (565 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 28 0.048 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 23 1.8 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 22 4.2 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 7.3 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 28.3 bits (60), Expect = 0.048 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 5/55 (9%) Frame = +3 Query: 219 ELPRNLKVMMKRKKI-----KMGSSRSQYRL*AEYQTTRPSATTTDNKHHWHKGN 368 EL RNL + ++ KI +M + ++ R A+ Q +AT N HH H G+ Sbjct: 275 ELARNLNLTERQVKIWFQNRRMKNKKNSQRQAAQQQNNNNAATNNQN-HHHHAGH 328 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 23.0 bits (47), Expect = 1.8 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 Query: 134 PHSKILSPILMDHI 93 PH L+PIL DHI Sbjct: 184 PHQGPLTPILYDHI 197 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 21.8 bits (44), Expect = 4.2 Identities = 9/41 (21%), Positives = 20/41 (48%) Frame = -1 Query: 508 YLYTIYSIDYNCISVHLMIIIQHLQLNDVSHVRSLVFLVKI 386 +LY + C + I H + N ++ + SL ++++I Sbjct: 136 FLYIFTYLSVTCYVTYAWSPIDHTESNIINDMCSLYYILQI 176 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.0 bits (42), Expect = 7.3 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +2 Query: 197 SKIDFISGVAKKPESDDEKKENQ 265 S ++ + AKK ESD N+ Sbjct: 445 SNVEVVQEEAKKEESDSNNNNNK 467 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,844 Number of Sequences: 336 Number of extensions: 1583 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13890653 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -