BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10779X (559 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 27 0.55 L10440-1|AAA29360.1| 154|Anopheles gambiae transposase protein. 23 5.1 AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical prote... 23 6.8 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 26.6 bits (56), Expect = 0.55 Identities = 29/92 (31%), Positives = 41/92 (44%), Gaps = 1/92 (1%) Frame = +1 Query: 124 PSCCSLPQKRD*KERVYSIPSLQRRRWSLCSSKAVWHNTGSLAQKSAEFLLQLLRNAESN 303 PS L R VYS+ RRRWSLC K + + Q+S LL S Sbjct: 9 PSGARLSISRGSPTGVYSV----RRRWSLC-QKLHFRDQVCCVQRSPPHWPYLL--CSSC 61 Query: 304 ADNKTLDVDRLVIDHIQVNRAPCLR-RRTYRA 396 + L + +L +DH + +A L+ R +RA Sbjct: 62 SAMPALKILQLNVDHCREGQALALQAAREHRA 93 >L10440-1|AAA29360.1| 154|Anopheles gambiae transposase protein. Length = 154 Score = 23.4 bits (48), Expect = 5.1 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 333 ASHRPHSGKSRALPTQTYIPCSRS 404 A+ RPH K + L Q PC +S Sbjct: 112 AAKRPHMKKKKVLFHQDNAPCHKS 135 >AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical protein protein. Length = 297 Score = 23.0 bits (47), Expect = 6.8 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = +3 Query: 339 HRPHSGKSRALPTQTYIPCSRSHQPLHVVSLPHRSMSQ 452 HR +G+S P+ + ++ HQ + L +R +S+ Sbjct: 195 HRQEAGQSLKGPSNNMLQANKPHQQVDEHELKNRIISK 232 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 598,520 Number of Sequences: 2352 Number of extensions: 13008 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52142868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -