BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10727 (617 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014298-2417|AAF48618.2| 639|Drosophila melanogaster CG9906-PA... 31 1.6 AY093928-1|AAM18339.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093927-1|AAM18338.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093926-1|AAM18337.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093925-1|AAM18336.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093924-1|AAM18335.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093923-1|AAM18334.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093922-1|AAM18333.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093921-1|AAM18332.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093920-1|AAM18331.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093919-1|AAM18330.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093918-1|AAM18329.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093917-1|AAM18328.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093916-1|AAM18327.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093915-1|AAM18326.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093914-1|AAM18325.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093913-1|AAM18324.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093912-1|AAM18323.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093911-1|AAM18322.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093909-1|AAM18320.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093908-1|AAM18319.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093907-1|AAM18318.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093906-1|AAM18317.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093905-1|AAM18316.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093904-1|AAM18315.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093903-1|AAM18314.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093902-1|AAM18313.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093901-1|AAM18312.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093900-1|AAM18311.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093899-1|AAM18310.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093898-1|AAM18309.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093897-1|AAM18308.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093896-1|AAM18307.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093895-1|AAM18306.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093894-1|AAM18305.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093893-1|AAM18304.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093892-1|AAM18303.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093891-1|AAM18302.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093890-1|AAM18301.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093889-1|AAM18300.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093888-1|AAM18299.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093887-1|AAM18298.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093886-1|AAM18297.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093885-1|AAM18296.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093884-1|AAM18295.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093883-1|AAM18294.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093882-1|AAM18293.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093881-1|AAM18292.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093880-1|AAM18291.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093879-1|AAM18290.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093878-1|AAM18289.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093877-1|AAM18288.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093876-1|AAM18287.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY093875-1|AAM18286.1| 121|Drosophila melanogaster syntaxin 4 p... 29 3.8 AY070922-1|AAL48544.1| 333|Drosophila melanogaster RE02884p pro... 29 3.8 AL021728-10|CAA16817.1| 315|Drosophila melanogaster EG:95B7.1 p... 29 3.8 AE014298-462|AAF45823.2| 333|Drosophila melanogaster CG2715-PA ... 29 3.8 X99488-1|CAA67846.1| 605|Drosophila melanogaster calnexin protein. 28 8.8 BT003313-1|AAO25073.1| 605|Drosophila melanogaster GH03249p pro... 28 8.8 AE014298-1754|AAG22345.2| 570|Drosophila melanogaster CG1924-PA... 28 8.8 AE014297-4372|ABI31215.1| 647|Drosophila melanogaster CG11958-P... 28 8.8 AE014297-4371|ABI31216.1| 605|Drosophila melanogaster CG11958-P... 28 8.8 AE014297-4370|AAN14170.1| 605|Drosophila melanogaster CG11958-P... 28 8.8 AE014297-4369|AAF56887.2| 605|Drosophila melanogaster CG11958-P... 28 8.8 >AE014298-2417|AAF48618.2| 639|Drosophila melanogaster CG9906-PA protein. Length = 639 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 412 TDFIDP*RPASEINDPNSH 356 TDF+ P P +EI+DPN H Sbjct: 256 TDFVPPVNPPAEIDDPNDH 274 >AY093928-1|AAM18339.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093927-1|AAM18338.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093926-1|AAM18337.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093925-1|AAM18336.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093924-1|AAM18335.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093923-1|AAM18334.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093922-1|AAM18333.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093921-1|AAM18332.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093920-1|AAM18331.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093919-1|AAM18330.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093918-1|AAM18329.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093917-1|AAM18328.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093916-1|AAM18327.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093915-1|AAM18326.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093914-1|AAM18325.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093913-1|AAM18324.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093912-1|AAM18323.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093911-1|AAM18322.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093909-1|AAM18320.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093908-1|AAM18319.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093907-1|AAM18318.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093906-1|AAM18317.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093905-1|AAM18316.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093904-1|AAM18315.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093903-1|AAM18314.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093902-1|AAM18313.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093901-1|AAM18312.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093900-1|AAM18311.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093899-1|AAM18310.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093898-1|AAM18309.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093897-1|AAM18308.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093896-1|AAM18307.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093895-1|AAM18306.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093894-1|AAM18305.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093893-1|AAM18304.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093892-1|AAM18303.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093891-1|AAM18302.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093890-1|AAM18301.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093889-1|AAM18300.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093888-1|AAM18299.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093887-1|AAM18298.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093886-1|AAM18297.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093885-1|AAM18296.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093884-1|AAM18295.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093883-1|AAM18294.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093882-1|AAM18293.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093881-1|AAM18292.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093880-1|AAM18291.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093879-1|AAM18290.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093878-1|AAM18289.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093877-1|AAM18288.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093876-1|AAM18287.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY093875-1|AAM18286.1| 121|Drosophila melanogaster syntaxin 4 protein. Length = 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 54 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 84 >AY070922-1|AAL48544.1| 333|Drosophila melanogaster RE02884p protein. Length = 333 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 144 NDFKANLPAENDYSLEARMKRTIFYGLHQTF 174 >AL021728-10|CAA16817.1| 315|Drosophila melanogaster EG:95B7.1 protein. Length = 315 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 144 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 174 >AE014298-462|AAF45823.2| 333|Drosophila melanogaster CG2715-PA protein. Length = 333 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 559 NSIKSNTDKETTYSMQLNIKVEFCNGIHQTF 467 N K+N E YS++ +K G+HQTF Sbjct: 144 NDFKANLPAENDYSLEARMKRTLFYGLHQTF 174 >X99488-1|CAA67846.1| 605|Drosophila melanogaster calnexin protein. Length = 605 Score = 28.3 bits (60), Expect = 8.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 412 TDFIDP*RPASEINDPNSH 356 TDF P P +EI+DPN H Sbjct: 271 TDFKPPVNPPAEIDDPNDH 289 >BT003313-1|AAO25073.1| 605|Drosophila melanogaster GH03249p protein. Length = 605 Score = 28.3 bits (60), Expect = 8.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 412 TDFIDP*RPASEINDPNSH 356 TDF P P +EI+DPN H Sbjct: 271 TDFKPPVNPPAEIDDPNDH 289 >AE014298-1754|AAG22345.2| 570|Drosophila melanogaster CG1924-PA protein. Length = 570 Score = 28.3 bits (60), Expect = 8.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 412 TDFIDP*RPASEINDPNSH 356 TDF P P +EI+DPN H Sbjct: 267 TDFKPPVNPPAEIDDPNDH 285 >AE014297-4372|ABI31215.1| 647|Drosophila melanogaster CG11958-PC, isoform C protein. Length = 647 Score = 28.3 bits (60), Expect = 8.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 412 TDFIDP*RPASEINDPNSH 356 TDF P P +EI+DPN H Sbjct: 271 TDFKPPVNPPAEIDDPNDH 289 >AE014297-4371|ABI31216.1| 605|Drosophila melanogaster CG11958-PD, isoform D protein. Length = 605 Score = 28.3 bits (60), Expect = 8.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 412 TDFIDP*RPASEINDPNSH 356 TDF P P +EI+DPN H Sbjct: 271 TDFKPPVNPPAEIDDPNDH 289 >AE014297-4370|AAN14170.1| 605|Drosophila melanogaster CG11958-PB, isoform B protein. Length = 605 Score = 28.3 bits (60), Expect = 8.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 412 TDFIDP*RPASEINDPNSH 356 TDF P P +EI+DPN H Sbjct: 271 TDFKPPVNPPAEIDDPNDH 289 >AE014297-4369|AAF56887.2| 605|Drosophila melanogaster CG11958-PA, isoform A protein. Length = 605 Score = 28.3 bits (60), Expect = 8.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 412 TDFIDP*RPASEINDPNSH 356 TDF P P +EI+DPN H Sbjct: 271 TDFKPPVNPPAEIDDPNDH 289 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,423,857 Number of Sequences: 53049 Number of extensions: 307304 Number of successful extensions: 476 Number of sequences better than 10.0: 64 Number of HSP's better than 10.0 without gapping: 475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 476 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2538517050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -