BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10727 (617 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z72507-13|CAH60789.1| 515|Caenorhabditis elegans Hypothetical p... 27 8.1 Z72507-10|CAA96629.1| 531|Caenorhabditis elegans Hypothetical p... 27 8.1 >Z72507-13|CAH60789.1| 515|Caenorhabditis elegans Hypothetical protein F17C11.7b protein. Length = 515 Score = 27.5 bits (58), Expect = 8.1 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = -2 Query: 97 IKLKLKTTSKQTCKLTI*KGIYILQIKSYP 8 ++ K+K ++ QTC+LTI +L+++ YP Sbjct: 365 LQYKMKLSAGQTCELTIPFDKQLLRLEQYP 394 >Z72507-10|CAA96629.1| 531|Caenorhabditis elegans Hypothetical protein F17C11.7a protein. Length = 531 Score = 27.5 bits (58), Expect = 8.1 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = -2 Query: 97 IKLKLKTTSKQTCKLTI*KGIYILQIKSYP 8 ++ K+K ++ QTC+LTI +L+++ YP Sbjct: 381 LQYKMKLSAGQTCELTIPFDKQLLRLEQYP 410 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,066,190 Number of Sequences: 27780 Number of extensions: 176855 Number of successful extensions: 248 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 244 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 248 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1342816466 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -