BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10722 (391 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1177 + 35147036-35147038,35147128-35147220,35147322-351474... 138 1e-33 09_02_0194 - 5641920-5642867,5642895-5642983,5643049-5643280 29 1.3 08_02_1601 - 28138206-28138597,28138928-28139054,28139150-281399... 27 4.0 09_04_0040 - 14029565-14029810,14030904-14031182,14032056-14032832 27 7.0 05_01_0554 + 4856131-4856605,4858051-4858098,4860611-4860792,486... 27 7.0 04_01_0268 - 3585907-3588086,3590167-3590326 27 7.0 05_03_0038 + 7612866-7613132,7615691-7616608 26 9.2 >01_06_1177 + 35147036-35147038,35147128-35147220,35147322-35147406, 35147588-35147760 Length = 117 Score = 138 bits (335), Expect = 1e-33 Identities = 59/89 (66%), Positives = 74/89 (83%) Frame = +2 Query: 2 TRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYPM 181 T KRRNGGR KHGRGHVK +RC+NCA+C PKDKAIK+F +RNIVE AA+RD+ +A V+ Sbjct: 2 TFKRRNGGRNKHGRGHVKYIRCSNCAKCCPKDKAIKRFQVRNIVEQAAIRDVQEACVHDG 61 Query: 182 FQLPKLYAKLHYCVSCAIHSKVVRTDRRK 268 + LPKLYAK+H+CVSCAIH+ +VR R+ Sbjct: 62 YVLPKLYAKVHHCVSCAIHAHIVRVRSRE 90 >09_02_0194 - 5641920-5642867,5642895-5642983,5643049-5643280 Length = 422 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 208 APLLRVMRHPQQSCQDRSKKDRRIRTPPK 294 +PL R++R C +KK+RR+R P K Sbjct: 317 SPLFRILRTLFGLCSAEAKKNRRLRNPAK 345 >08_02_1601 - 28138206-28138597,28138928-28139054,28139150-28139914, 28140714-28140929,28141433-28141903 Length = 656 Score = 27.5 bits (58), Expect = 4.0 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -1 Query: 166 GIVNISDRRRFYDVPNHELFDSLVLWHAPRAVCASHSFN--VTTSMLGASSIT 14 GI + D +YD + LF+ L+ P A +SH+F+ V T + S+ T Sbjct: 439 GIDMVDDGMPYYDAMDDNLFNDLLSSVQPSAGSSSHAFSGPVLTQEVNNSTYT 491 >09_04_0040 - 14029565-14029810,14030904-14031182,14032056-14032832 Length = 433 Score = 26.6 bits (56), Expect = 7.0 Identities = 15/50 (30%), Positives = 20/50 (40%) Frame = +2 Query: 2 TRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVR 151 T RR A G G AV C +CA P + A+ + + A R Sbjct: 78 TSSRRTDPPAGAGAGEDDAVACPSCAEPFPSELAVSDHLDGCLAAAGGAR 127 >05_01_0554 + 4856131-4856605,4858051-4858098,4860611-4860792, 4861409-4863136 Length = 810 Score = 26.6 bits (56), Expect = 7.0 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -1 Query: 148 DRRRFYDVPNHELFD 104 DR FYD PN+E FD Sbjct: 354 DRTLFYDEPNYEAFD 368 >04_01_0268 - 3585907-3588086,3590167-3590326 Length = 779 Score = 26.6 bits (56), Expect = 7.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -2 Query: 255 VLTTLLWMAHDTQ*WSLAYNLGSWNIGYT 169 V +LW+A+ W+ Y LGS ++G T Sbjct: 96 VRALVLWLAYQLGGWAGTYALGSMSLGRT 124 >05_03_0038 + 7612866-7613132,7615691-7616608 Length = 394 Score = 26.2 bits (55), Expect = 9.2 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 208 APLLRVMRHPQQSCQDRSKKDRRIRTPPK 294 +PL R++R C +KK+RR+R K Sbjct: 305 SPLFRILRSLFGLCSAEAKKNRRLRNSAK 333 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,871,146 Number of Sequences: 37544 Number of extensions: 190280 Number of successful extensions: 513 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 513 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 660830060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -