BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10722 (391 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein ... 164 1e-42 AY341235-1|AAR13799.1| 196|Anopheles gambiae transferrin-like p... 26 0.56 AY341234-1|AAR13798.1| 196|Anopheles gambiae transferrin-like p... 26 0.56 AY341233-1|AAR13797.1| 196|Anopheles gambiae transferrin-like p... 26 0.56 AY341232-1|AAR13796.1| 196|Anopheles gambiae transferrin-like p... 26 0.56 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 23 3.0 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 23 5.2 U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. 22 6.9 AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein p... 22 6.9 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 22 9.1 AY341149-1|AAR13713.1| 164|Anopheles gambiae aminopeptidase N p... 22 9.1 AY341147-1|AAR13711.1| 164|Anopheles gambiae aminopeptidase N p... 22 9.1 AY341146-1|AAR13710.1| 164|Anopheles gambiae aminopeptidase N p... 22 9.1 AJ973476-1|CAJ01523.1| 126|Anopheles gambiae hypothetical prote... 22 9.1 AJ697729-1|CAG26922.1| 126|Anopheles gambiae putative sensory a... 22 9.1 >AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein S26 protein. Length = 114 Score = 164 bits (398), Expect = 1e-42 Identities = 75/88 (85%), Positives = 80/88 (90%) Frame = +2 Query: 8 KRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYPMFQ 187 +RRNGGR KH RGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDI+DASVY + Sbjct: 3 ERRNGGRCKHNRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISDASVYSSYV 62 Query: 188 LPKLYAKLHYCVSCAIHSKVVRTDRRKT 271 LPKLYAKLHYCVSCAIHSKVVR ++T Sbjct: 63 LPKLYAKLHYCVSCAIHSKVVRNRSKET 90 Score = 44.0 bits (99), Expect = 2e-06 Identities = 18/30 (60%), Positives = 25/30 (83%) Frame = +1 Query: 250 QDRSKKDRRIRTPPKSNFPRDMSRPQAVQR 339 ++RSK+ RRIRTPP+ +FP+DM+R Q QR Sbjct: 84 RNRSKETRRIRTPPQRSFPKDMNRQQNAQR 113 >AY341235-1|AAR13799.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 25.8 bits (54), Expect = 0.56 Identities = 11/44 (25%), Positives = 19/44 (43%) Frame = +2 Query: 32 KHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDIND 163 K G+GH + + N C P+ I N+ + + D N+ Sbjct: 50 KEGKGHDRFEKLRNAKACFPEFGGIASIAFVNVGRSRGIFDRNE 93 >AY341234-1|AAR13798.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 25.8 bits (54), Expect = 0.56 Identities = 11/44 (25%), Positives = 19/44 (43%) Frame = +2 Query: 32 KHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDIND 163 K G+GH + + N C P+ I N+ + + D N+ Sbjct: 50 KEGKGHDRFEKLRNAKACFPEFGGIASIAFVNVGRSRGIFDRNE 93 >AY341233-1|AAR13797.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 25.8 bits (54), Expect = 0.56 Identities = 11/44 (25%), Positives = 19/44 (43%) Frame = +2 Query: 32 KHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDIND 163 K G+GH + + N C P+ I N+ + + D N+ Sbjct: 50 KEGKGHDRFEKLRNAKACFPEFGGIASIAFVNVGRSRGIFDRNE 93 >AY341232-1|AAR13796.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 25.8 bits (54), Expect = 0.56 Identities = 11/44 (25%), Positives = 19/44 (43%) Frame = +2 Query: 32 KHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDIND 163 K G+GH + + N C P+ I N+ + + D N+ Sbjct: 50 KEGKGHDRFEKLRNAKACFPEFGGIASIAFVNVGRSRGIFDRNE 93 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.4 bits (48), Expect = 3.0 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = +1 Query: 196 VIR*APLLRVMRHPQQSCQDRSKKDRRIRTPPKSNFPRDMSRPQAVQR 339 V+R P R + QQ Q + ++ PP+ R +PQ Q+ Sbjct: 423 VVRSCPSQRQRQLQQQQQQQQQQQQGERYVPPQLRQQRQQQQPQQQQQ 470 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 22.6 bits (46), Expect = 5.2 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +2 Query: 239 SKVVRTDRRKTEESVL 286 S VVR +RRK +ESV+ Sbjct: 216 STVVRKNRRKPKESVI 231 >U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. Length = 278 Score = 22.2 bits (45), Expect = 6.9 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +2 Query: 269 TEESVLLPRVTSLGTCHVHRQ 331 T+ S+ PR+T T HV+ + Sbjct: 176 TDGSIFPPRITKNSTLHVYEK 196 >AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein protein. Length = 298 Score = 22.2 bits (45), Expect = 6.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 38 GRGHVKAVRCTNCARCV 88 G + KAV CTN +C+ Sbjct: 262 GAANHKAVNCTNDVKCL 278 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 21.8 bits (44), Expect = 9.1 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +1 Query: 241 QSCQDRSKKDRRIRTPPKSNFPR 309 + C D+ K+ R + PKS F R Sbjct: 453 EDCYDKEKEHRIPYSLPKSTFDR 475 >AY341149-1|AAR13713.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 21.8 bits (44), Expect = 9.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 181 HWVYRGIVNISDRRRFYDVPNH 116 H++YRG V SDR + + H Sbjct: 61 HFLYRGSVVTSDRTWWIPITYH 82 >AY341147-1|AAR13711.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 21.8 bits (44), Expect = 9.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 181 HWVYRGIVNISDRRRFYDVPNH 116 H++YRG V SDR + + H Sbjct: 61 HFLYRGSVVTSDRTWWIPITYH 82 >AY341146-1|AAR13710.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 21.8 bits (44), Expect = 9.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 181 HWVYRGIVNISDRRRFYDVPNH 116 H++YRG V SDR + + H Sbjct: 61 HFLYRGSVVTSDRTWWIPITYH 82 >AJ973476-1|CAJ01523.1| 126|Anopheles gambiae hypothetical protein protein. Length = 126 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +2 Query: 68 TNCARCVPKDKAIKKFVIRNIVE 136 T+CA+C K K+ + VI +++ Sbjct: 70 TDCAKCSEKQKSGTEKVINYLID 92 >AJ697729-1|CAG26922.1| 126|Anopheles gambiae putative sensory appendage protein SAP-3 protein. Length = 126 Score = 21.8 bits (44), Expect = 9.1 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +2 Query: 68 TNCARCVPKDKAIKKFVIRNIVE 136 T+CA+C K K+ + VI +++ Sbjct: 70 TDCAKCSEKQKSGTEKVINYLID 92 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 363,034 Number of Sequences: 2352 Number of extensions: 6583 Number of successful extensions: 26 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 30356973 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -