BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10711 (493 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 27 0.14 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 27 0.14 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 3.1 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 3.1 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 3.1 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 22 4.1 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 4.1 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 4.1 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 4.1 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 5.4 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 21 7.1 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 7.1 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 7.1 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 9.4 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 26.6 bits (56), Expect = 0.14 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = +2 Query: 89 IRRNEKIAVHCTVRGAKAEEILER---GLKVREY-ELRRDNFSATGNFGFGIQEHI 244 + RN+ +A+HC +G I+ + G K EY ELR ++ + G + +H+ Sbjct: 721 VERNKHVALHCQAQGVPTPTIVWKKATGSKSGEYEELRERAYTKILSNGTLLLQHV 776 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 26.6 bits (56), Expect = 0.14 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = +2 Query: 89 IRRNEKIAVHCTVRGAKAEEILER---GLKVREY-ELRRDNFSATGNFGFGIQEHI 244 + RN+ +A+HC +G I+ + G K EY ELR ++ + G + +H+ Sbjct: 717 VERNKHVALHCQAQGVPTPTIVWKKATGSKSGEYEELRERAYTKILSNGTLLLQHV 772 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 140 AEEILERGLKVREYELRRDNFSATGNFGFGIQ 235 AEE +G+ Y + R+ S+T GF ++ Sbjct: 386 AEERRVQGVTKPRYMVWRETISSTATLGFRVE 417 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 140 AEEILERGLKVREYELRRDNFSATGNFGFGIQ 235 AEE +G+ Y + R+ S+T GF ++ Sbjct: 301 AEERRVQGVTKPRYMVWRETISSTATLGFRVE 332 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 140 AEEILERGLKVREYELRRDNFSATGNFGFGIQ 235 AEE +G+ Y + R+ S+T GF ++ Sbjct: 620 AEERRVQGVTKPRYMVWRETISSTATLGFRVE 651 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.8 bits (44), Expect = 4.1 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 45 SLYFPRLGIQCGLLVSVVMKRLLSIVQS 128 SL+ LGI+CG + +++ L I Q+ Sbjct: 462 SLFRINLGIECGYEIKKLLRYKLLISQN 489 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 186 CGVTTSPPRVILASVFKN 239 C + PPRVIL+S K+ Sbjct: 626 CNLGLEPPRVILSSGAKS 643 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 186 CGVTTSPPRVILASVFKN 239 C + PPRVIL+S K+ Sbjct: 626 CNLGLEPPRVILSSGAKS 643 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 186 CGVTTSPPRVILASVFKN 239 C + PPRVIL+S K+ Sbjct: 626 CNLGLEPPRVILSSGAKS 643 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 5.4 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +1 Query: 322 NVAHRRRKTGKVG 360 NVA R TGKVG Sbjct: 923 NVASRMESTGKVG 935 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.0 bits (42), Expect = 7.1 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -3 Query: 371 RWGNPTFPVLRLLCATLKPGR 309 RW PT P LL A GR Sbjct: 443 RWTTPTTPHSPLLVAPFGAGR 463 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.0 bits (42), Expect = 7.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 348 RKSGISPPPHKGRCYEVV 401 R + +SPPP K R +VV Sbjct: 898 RGTVVSPPPTKRRTMKVV 915 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.0 bits (42), Expect = 7.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 348 RKSGISPPPHKGRCYEVV 401 R + +SPPP K R +VV Sbjct: 936 RGTVVSPPPTKRRTMKVV 953 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 20.6 bits (41), Expect = 9.4 Identities = 5/11 (45%), Positives = 9/11 (81%) Frame = -3 Query: 371 RWGNPTFPVLR 339 +WGNP P+++ Sbjct: 841 KWGNPNRPIVQ 851 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,940 Number of Sequences: 438 Number of extensions: 3289 Number of successful extensions: 14 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13544190 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -