BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10703 (660 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0373 - 13194723-13195847,13196219-13196809 29 4.3 11_01_0232 + 1794081-1795175,1796087-1796782 28 7.6 01_06_0751 + 31690411-31690443,31692900-31694240 28 7.6 >05_03_0373 - 13194723-13195847,13196219-13196809 Length = 571 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -2 Query: 446 VSEFGGTWFQLRR*WRVETRSVIDFDLRCSAR 351 V+E G + QL+R WR + R ++D D R R Sbjct: 502 VNEAGQRFLQLQREWRSDARGIVDGDGRFKFR 533 >11_01_0232 + 1794081-1795175,1796087-1796782 Length = 596 Score = 27.9 bits (59), Expect = 7.6 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +2 Query: 239 VRRSHGCGHRF 271 +RR HGCGHRF Sbjct: 544 LRRGHGCGHRF 554 >01_06_0751 + 31690411-31690443,31692900-31694240 Length = 457 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +2 Query: 542 ISEVPERVD-PQPPAAVLASSPFVTSQPT 625 I E+P+R + P PPAA P T Q T Sbjct: 195 IDELPDRAEAPPPPAAASTEQPEATEQAT 223 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,219,498 Number of Sequences: 37544 Number of extensions: 341746 Number of successful extensions: 909 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 887 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 908 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -