BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10699X (332 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 3.0 DQ494417-1|ABF55368.1| 42|Apis mellifera telomerase reverse tr... 20 9.1 AM158085-1|CAJ43389.1| 171|Apis mellifera globin 1 protein. 20 9.1 AM158084-1|CAJ43388.1| 171|Apis mellifera globin 1 protein. 20 9.1 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 3.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 185 PWPLIKSCIPVMTSPGV*KRG 123 P +++S P+MT P KRG Sbjct: 975 PGGVVQSQQPIMTDPSPFKRG 995 >DQ494417-1|ABF55368.1| 42|Apis mellifera telomerase reverse transcriptase protein. Length = 42 Score = 19.8 bits (39), Expect = 9.1 Identities = 9/32 (28%), Positives = 13/32 (40%) Frame = +1 Query: 160 IQDFMRGHGTYAEDDCLKASVAGVMQKVNKLI 255 +Q + GTY + CL + K N I Sbjct: 7 LQSLKKDFGTYFQQYCLHHKILIKKNKCNAFI 38 >AM158085-1|CAJ43389.1| 171|Apis mellifera globin 1 protein. Length = 171 Score = 19.8 bits (39), Expect = 9.1 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 211 KASVAGVMQKVNKLIAFAH 267 +A AGV+ +N +I F H Sbjct: 83 QAHCAGVITALNNVIDFLH 101 >AM158084-1|CAJ43388.1| 171|Apis mellifera globin 1 protein. Length = 171 Score = 19.8 bits (39), Expect = 9.1 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 211 KASVAGVMQKVNKLIAFAH 267 +A AGV+ +N +I F H Sbjct: 83 QAHCAGVITALNNVIDFLH 101 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,551 Number of Sequences: 438 Number of extensions: 1358 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7466580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -