BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10697X (450 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 25 0.50 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 24 0.67 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 24 0.67 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 24 0.67 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 24 0.88 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 24 0.88 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 24 0.88 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 24 0.88 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 24 0.88 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 24 0.88 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 24 0.88 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 24 0.88 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 24 0.88 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 24 0.88 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 24 0.88 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 24 0.88 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 24 0.88 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 24 0.88 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 24 0.88 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 24 0.88 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 1.2 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 1.2 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 1.2 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 1.2 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 1.2 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 1.2 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 1.2 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 1.2 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 1.2 S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 21 4.7 S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 21 8.2 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 8.2 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 24.6 bits (51), Expect = 0.50 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S DTS+FR P+ Sbjct: 107 LSDKLESSDDTSLFRGPK 124 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 0.67 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L +KL +S D S+FR PE Sbjct: 102 LSNKLESSDDISLFRGPE 119 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 0.67 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L +KL +S D S+FR PE Sbjct: 102 LSNKLESSDDISLFRGPE 119 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 24.2 bits (50), Expect = 0.67 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L +KL +S D S+FR PE Sbjct: 102 LSNKLESSDDISLFRGPE 119 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.8 bits (49), Expect = 0.88 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.8 bits (49), Expect = 0.88 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 0.88 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 0.88 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 0.88 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 0.88 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 0.88 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 23.8 bits (49), Expect = 0.88 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.8 bits (49), Expect = 0.88 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.8 bits (49), Expect = 0.88 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 23.8 bits (49), Expect = 0.88 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.8 bits (49), Expect = 0.88 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.8 bits (49), Expect = 0.88 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.8 bits (49), Expect = 0.88 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.8 bits (49), Expect = 0.88 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.8 bits (49), Expect = 0.88 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S D S+FR PE Sbjct: 102 LSDKLESSDDISLFRGPE 119 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 1.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S TS+FR PE Sbjct: 99 LSEKLESSDGTSLFRGPE 116 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 1.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S TS+FR PE Sbjct: 99 LSEKLESSDGTSLFRGPE 116 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 1.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S TS+FR PE Sbjct: 99 LSEKLESSDGTSLFRGPE 116 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 1.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S TS+FR PE Sbjct: 99 LSEKLESSDGTSLFRGPE 116 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 1.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S TS+FR PE Sbjct: 99 LSEKLESSDGTSLFRGPE 116 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 1.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S TS+FR PE Sbjct: 99 LSEKLESSDGTSLFRGPE 116 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 23.4 bits (48), Expect = 1.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S TS+FR PE Sbjct: 99 LSEKLESSDGTSLFRGPE 116 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 23.4 bits (48), Expect = 1.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 313 LGSKLSASHDTSIFRTPE 260 L KL +S TS+FR PE Sbjct: 99 LSEKLESSDGTSLFRGPE 116 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 23.4 bits (48), Expect = 1.2 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 126 KNYT*VLLLSRKRRLWRHLVSDKSLS 203 +NY + L ++KR + H V+ KSLS Sbjct: 448 ENYKSLNLAAQKREYYSHYVAFKSLS 473 Score = 22.2 bits (45), Expect = 2.7 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 Query: 244 YENFSPEHQNRTTIDSDLSLT 182 + N EH NRT D + LT Sbjct: 271 WRNLMDEHSNRTNSDPRMILT 291 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 21.4 bits (43), Expect = 4.7 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = -2 Query: 398 LLILPAFLYVIILVFPFPFVGGCQ 327 L IL +++Y+++ + GGC+ Sbjct: 91 LTILISYIYILMAILRMSADGGCR 114 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 20.6 bits (41), Expect = 8.2 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -2 Query: 434 AASVFSSSILCHLLILPAFLYVIILVFPFPFVGGCQ 327 A VFSS IL +++Y+++ + GGC+ Sbjct: 85 AVGVFSSPT-----ILISYIYILMAILRMSADGGCR 115 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 20.6 bits (41), Expect = 8.2 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +1 Query: 226 QVKSFHINSALILES*KWTCHGTQITSSPNS 318 Q + H ++A ++ + + HG I SSP+S Sbjct: 791 QSQQRHQHAAQMIYGHQQSHHGLHINSSPSS 821 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,168 Number of Sequences: 438 Number of extensions: 2584 Number of successful extensions: 33 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -