BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10695 (717 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 24 1.7 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 2.9 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/20 (40%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = +3 Query: 132 HDGTP-FFYHSYSKQKPKIN 188 H+G F++H + KQ+P +N Sbjct: 183 HEGRKQFYFHQFYKQQPDLN 202 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +1 Query: 406 QSIFVLKNNKLFYYNYFQRYINEKHKKKNLILVLIS 513 Q ++K+N L YN+ + + H K+ L+ ++ S Sbjct: 209 QEYEIMKDN-LLLYNHARLMSQDNHSKEYLVSIMFS 243 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,439 Number of Sequences: 438 Number of extensions: 3912 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -