BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10694 (760 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC962.02c |bir1|cut17, pbh1, SPCP31B10.10c|survivin homolog|Sc... 27 3.8 SPAC8F11.07c |cdc24||DNA replication protein Cdc24|Schizosacchar... 26 5.1 SPBC418.01c |his4|SPBC887.20c|imidazoleglycerol-phosphate syntha... 26 6.7 SPAC24C9.10c |mrp4||mitochondrial ribosomal protein subunit S2|S... 25 8.9 >SPCC962.02c |bir1|cut17, pbh1, SPCP31B10.10c|survivin homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 997 Score = 26.6 bits (56), Expect = 3.8 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 126 ANSTARVDNVSCYSC 82 +NS R+DNV+CY C Sbjct: 57 SNSEERLDNVTCYMC 71 >SPAC8F11.07c |cdc24||DNA replication protein Cdc24|Schizosaccharomyces pombe|chr 1|||Manual Length = 501 Score = 26.2 bits (55), Expect = 5.1 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +2 Query: 635 LHGLFYLVFH--YNYIKHNLFRCEDSKI 712 LH FYL+FH +N +K + R S+I Sbjct: 118 LHSSFYLLFHEPFNILKGSTLRFSQSRI 145 >SPBC418.01c |his4|SPBC887.20c|imidazoleglycerol-phosphate synthase|Schizosaccharomyces pombe|chr 2|||Manual Length = 541 Score = 25.8 bits (54), Expect = 6.7 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 97 DIVHTRRAIRSVSGNVELKNSVDEDGYSADY 189 D+V RA ++ L N +D+DG +A Y Sbjct: 442 DVVELTRACEAMGAGEVLLNCMDQDGSNAGY 472 >SPAC24C9.10c |mrp4||mitochondrial ribosomal protein subunit S2|Schizosaccharomyces pombe|chr 1|||Manual Length = 263 Score = 25.4 bits (53), Expect = 8.9 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +2 Query: 185 IMLPYSTSSCGSV*YXXXXXXXXXRPNGYGPRQGLHYLSYDQ 310 + LP SS + + +P YG R+G+H +S DQ Sbjct: 48 LSLPLLLSSGAHLGHSTSIWNPYTQPFIYGKREGIHIISLDQ 89 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,984,984 Number of Sequences: 5004 Number of extensions: 58630 Number of successful extensions: 152 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 152 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 363302114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -