BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10693 (768 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0394 + 23758392-23758625,23759097-23759273,23759349-237594... 29 5.4 03_01_0005 + 46370-46454,46962-47071,47381-47545,47672-48463,487... 28 9.4 >03_05_0394 + 23758392-23758625,23759097-23759273,23759349-23759453, 23759640-23759681,23759763-23759960,23760037-23760165, 23760248-23760377,23761119-23761179,23761241-23761322, 23761402-23761653 Length = 469 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 89 NFPCNRYQKVSYSILIGKRTR 27 +FP RY KV Y +IGKR R Sbjct: 145 HFPRKRYIKVEYPTIIGKRVR 165 >03_01_0005 + 46370-46454,46962-47071,47381-47545,47672-48463, 48730-48840,48935-49195,49415-49638,49735-49855, 50673-51214,51302-51488,51569-51895,52047-52197, 52287-52424,52918-53013,53276-53357,54411-54679, 54769-54882,55050-55288,55488-55715,55799-55951, 56479-56616,57061-57188,57598-57718,58142-58306, 59486-59633,59772-59898,60025-60118,60119-60268, 60577-60624,60712-60819,61040-61114,61225-61275, 61341-61487,61584-61714,61944-62031,62204-62266, 62336-62582,62830-62981,63056-63126,63214-63370, 63520-63687 Length = 2323 Score = 27.9 bits (59), Expect = 9.4 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -2 Query: 554 CT*FIYESSIIKGGNRAFGQKKMLLICQYRLILI*SSPS 438 C +Y+S IIKG R FG L + RL L+ S S Sbjct: 1104 CVKGVYDSKIIKGAERFFGLYAQRLTTRDRLHLVWSLSS 1142 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,453,420 Number of Sequences: 37544 Number of extensions: 333840 Number of successful extensions: 672 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 672 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -