BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10693 (768 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016443-3|AAC24281.1| 395|Caenorhabditis elegans Hypothetical ... 31 0.68 Z70279-5|CAA94243.3| 137|Caenorhabditis elegans Hypothetical pr... 29 2.8 AL023841-3|CAC42357.1| 137|Caenorhabditis elegans Hypothetical ... 29 2.8 AF016443-2|AAC24272.1| 359|Caenorhabditis elegans Hypothetical ... 29 2.8 AF016443-1|AAC24277.1| 366|Caenorhabditis elegans Hypothetical ... 29 3.6 AL110485-5|CAB60375.1| 1002|Caenorhabditis elegans Hypothetical ... 28 8.4 AL110485-3|CAB60351.1| 2145|Caenorhabditis elegans Hypothetical ... 28 8.4 >AF016443-3|AAC24281.1| 395|Caenorhabditis elegans Hypothetical protein C17E7.7 protein. Length = 395 Score = 31.5 bits (68), Expect = 0.68 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = -1 Query: 438 KEYGSKPALNKG*YLTCYLCKMSFRRVL*LPMEY--KVNNSFF 316 K++GS+P LTC CKM FRRV+ +EY K +N+ F Sbjct: 60 KDFGSQPKQ----VLTCDACKMFFRRVVTEKLEYTCKCSNNCF 98 >Z70279-5|CAA94243.3| 137|Caenorhabditis elegans Hypothetical protein K11E8.1b protein. Length = 137 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 616 SRRDAGLCNVQIVTSANYCHMR 681 S DA C +QI+ NYCH R Sbjct: 107 SEADASCCIMQILDGVNYCHQR 128 >AL023841-3|CAC42357.1| 137|Caenorhabditis elegans Hypothetical protein K11E8.1b protein. Length = 137 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 616 SRRDAGLCNVQIVTSANYCHMR 681 S DA C +QI+ NYCH R Sbjct: 107 SEADASCCIMQILDGVNYCHQR 128 >AF016443-2|AAC24272.1| 359|Caenorhabditis elegans Hypothetical protein C17E7.6 protein. Length = 359 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 396 LTCYLCKMSFRRVL*LPMEYK 334 LTC CKM FRR++ L +YK Sbjct: 41 LTCDACKMFFRRIVILKKDYK 61 >AF016443-1|AAC24277.1| 366|Caenorhabditis elegans Hypothetical protein C17E7.5 protein. Length = 366 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 396 LTCYLCKMSFRRVL*LPMEYK 334 LTC CKM +RR++ L EYK Sbjct: 54 LTCDACKMFYRRIVILNREYK 74 >AL110485-5|CAB60375.1| 1002|Caenorhabditis elegans Hypothetical protein Y46G5A.6 protein. Length = 1002 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -2 Query: 569 TDFIVCT*FIYESSIIKGGNRAFGQKKMLLI 477 T IVCT Y+ KGG RA+ Q LLI Sbjct: 377 TQVIVCTPEKYDVVTRKGGERAYNQMVRLLI 407 >AL110485-3|CAB60351.1| 2145|Caenorhabditis elegans Hypothetical protein Y46G5A.4 protein. Length = 2145 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -2 Query: 569 TDFIVCT*FIYESSIIKGGNRAFGQKKMLLI 477 T IVCT Y+ KGG RA+ Q LLI Sbjct: 577 TQVIVCTPEKYDVVTRKGGERAYNQMVRLLI 607 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,713,343 Number of Sequences: 27780 Number of extensions: 325695 Number of successful extensions: 678 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 678 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1840614650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -