BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10693 (768 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.4 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 3.1 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 5.5 DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 22 5.5 DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. 22 5.5 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.4 bits (48), Expect = 2.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 151 PILHQNFASNYLKPNRYAWLP 213 P+ HQ A YLKP+ A P Sbjct: 400 PVFHQEMALYYLKPSYDAQEP 420 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 522 QRWQSCIWTKKNVIDMSIQIDFNIIVSFKE 433 Q+ Q C+ K+N ID I++ + SF + Sbjct: 510 QKGQICLKEKENEIDFKIEVTEDCNKSFND 539 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 22.2 bits (45), Expect = 5.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 162 SKLRIELPKTKSLRVAAKACKTIF 233 S LR+ +PK K + + K + IF Sbjct: 449 SILRVSMPKIKDVNIIDKYSRIIF 472 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 22.2 bits (45), Expect = 5.5 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 522 QRWQSCIWTKKNVIDMSIQIDFNII 448 QR+ CI + N++D S NI+ Sbjct: 60 QRYNECILKQFNIVDESGNFKENIV 84 >DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. Length = 135 Score = 22.2 bits (45), Expect = 5.5 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 522 QRWQSCIWTKKNVIDMSIQIDFNII 448 QR+ CI + N++D S NI+ Sbjct: 60 QRYNECILKQFNIVDESGNFKENIV 84 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,241 Number of Sequences: 438 Number of extensions: 3968 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -