BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10692 (552 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41239| Best HMM Match : 7tm_6 (HMM E-Value=0.091) 30 1.4 SB_56770| Best HMM Match : Cadherin (HMM E-Value=0) 28 4.4 SB_51779| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 >SB_41239| Best HMM Match : 7tm_6 (HMM E-Value=0.091) Length = 581 Score = 29.9 bits (64), Expect = 1.4 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -2 Query: 146 YRQIFRVLTLLRVQTYFCVNFVFTNEICFFFN 51 +R IF ++ LL V Y V FVFT ICF N Sbjct: 226 FRVIFPLVILL-VSLYVLVGFVFTTWICFHSN 256 >SB_56770| Best HMM Match : Cadherin (HMM E-Value=0) Length = 1136 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/48 (22%), Positives = 25/48 (52%) Frame = -2 Query: 386 IRSNYFRREFNRYVFWFEILKREIPSLAPTPAIDLNLKDYSFPVTKIT 243 I+S + ++ F ++ + P++ T +DL++KD + +IT Sbjct: 829 IKSLFEHHSVTQFTFLVQVTNKAFPNIQATAKVDLSIKDVNNHAPEIT 876 >SB_51779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3610 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/48 (22%), Positives = 25/48 (52%) Frame = -2 Query: 386 IRSNYFRREFNRYVFWFEILKREIPSLAPTPAIDLNLKDYSFPVTKIT 243 I+S + ++ F ++ + P++ T +DL++KD + +IT Sbjct: 60 IKSLFEHHSVTQFTFLVQVTNKAFPNIQATAKVDLSIKDVNNHAPEIT 107 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,852,550 Number of Sequences: 59808 Number of extensions: 247042 Number of successful extensions: 457 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 457 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1276425465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -