BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10691 (806 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 24 1.6 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 21 8.7 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 21 8.7 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/41 (26%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +3 Query: 672 IIFS-KNNDYYKESETIDWQLYIQFERCR*ISNLYHIISFS 791 +++S K +Y++ I +YI + ISN+Y I++++ Sbjct: 33 VVYSFKRRIFYQDESPISRLVYIGTDLSYFISNVYQILAYN 73 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 21.4 bits (43), Expect = 8.7 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = +2 Query: 767 FISYNIFQCKMI 802 F+SYNI+ C+ + Sbjct: 192 FVSYNIYVCQTV 203 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 21.4 bits (43), Expect = 8.7 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = +2 Query: 767 FISYNIFQCKMI 802 F+SYNI+ C+ + Sbjct: 118 FVSYNIYVCQTV 129 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,340 Number of Sequences: 336 Number of extensions: 3750 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21999028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -