BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10691 (806 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 26 0.47 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 26 0.47 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 25 1.1 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 25 1.1 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 25 1.1 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 24 1.4 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 24 1.4 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 24 1.4 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 24 1.4 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 24 1.9 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 24 1.9 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 24 1.9 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 24 1.9 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 24 1.9 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 24 1.9 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 24 1.9 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 24 1.9 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 3.3 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 3.3 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 5.8 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 5.8 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 22 7.7 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 22 7.7 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.8 bits (54), Expect = 0.47 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 732 IAANLSFRSLYNNHYSY*KLYQNNFNELGIDTTLIY 625 I ++LS +++NN+Y Y NN+N + L Y Sbjct: 80 IISSLSNNTIHNNNYKY-NYNNNNYNNNNYNKKLYY 114 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.8 bits (54), Expect = 0.47 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 732 IAANLSFRSLYNNHYSY*KLYQNNFNELGIDTTLIY 625 I ++LS +++NN+Y Y NN+N + L Y Sbjct: 80 IISSLSNNTIHNNNYKY-NYNNNNYNNNNYNKKLYY 114 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -3 Query: 732 IAANLSFRSLYNNHYSY*KLYQNNFNEL 649 I ++LS YNN+ +Y KLY NN+ +L Sbjct: 81 IISSLSNNYNYNNN-NYKKLYCNNYKKL 107 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -3 Query: 732 IAANLSFRSLYNNHYSY*KLYQNNFNEL 649 I ++LS YNN+ +Y KLY NN+ +L Sbjct: 81 IISSLSNNYNYNNN-NYKKLYCNNYKKL 107 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -3 Query: 732 IAANLSFRSLYNNHYSY*KLYQNNFNEL 649 I ++LS YNN+ +Y KLY NN+ +L Sbjct: 81 IISSLSNNYNYNNN-NYKKLYCNNYRKL 107 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 732 IAANLSFRSLYNNHYSY*KLYQNNFNE 652 I ++LS +++NN+Y Y NN+N+ Sbjct: 81 IISSLSNNTIHNNNYKY-NYNNNNYNK 106 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 732 IAANLSFRSLYNNHYSY*KLYQNNFNE 652 I ++LS +++NN+Y Y NN+N+ Sbjct: 81 IISSLSNNTIHNNNYKY-NYNNNNYNK 106 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 732 IAANLSFRSLYNNHYSY*KLYQNNFNE 652 I ++LS +++NN+Y Y NN+N+ Sbjct: 81 IISSLSNNTIHNNNYKY-NYNNNNYNK 106 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 732 IAANLSFRSLYNNHYSY*KLYQNNFNE 652 I ++LS +++NN+Y Y NN+N+ Sbjct: 81 IISSLSNNTIHNNNYKY-NYNNNNYNK 106 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.8 bits (49), Expect = 1.9 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 732 IAANLSFRSLYNNHYSY*KLYQNNFN 655 I ++LS Y+N+ +Y Y NN+N Sbjct: 81 IISSLSNNYKYSNYNNYNNNYNNNYN 106 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.8 bits (49), Expect = 1.9 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 732 IAANLSFRSLYNNHYSY*KLYQNNFN 655 I ++LS Y+N+ +Y Y NN+N Sbjct: 81 IISSLSNNYKYSNYNNYNNNYNNNYN 106 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.8 bits (49), Expect = 1.9 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 732 IAANLSFRSLYNNHYSY*KLYQNNFN 655 I ++LS ++++NN+ +Y KL N N Sbjct: 81 IISSLSNKTIHNNNNNYKKLQYYNIN 106 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.8 bits (49), Expect = 1.9 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 732 IAANLSFRSLYNNHYSY*KLYQNNFN 655 I ++LS ++++NN+ +Y KL N N Sbjct: 81 IISSLSNKTIHNNNNNYKKLQYYNIN 106 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 23.8 bits (49), Expect = 1.9 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 732 IAANLSFRSLYNNHYSY*KLYQNNFN 655 I ++LS ++++NN+ +Y KL N N Sbjct: 81 IISSLSNKTIHNNNNNYKKLQYYNIN 106 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.8 bits (49), Expect = 1.9 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 732 IAANLSFRSLYNNHYSY*KLYQNNFN 655 I ++LS ++++NN+ +Y KL N N Sbjct: 81 IISSLSNKTIHNNNNNYKKLQYYNIN 106 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.8 bits (49), Expect = 1.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -3 Query: 717 SFRSLYNNHYSY*KLYQNNFNEL 649 ++ + YNN+ +Y Y NN+ +L Sbjct: 329 NYNNNYNNYNNYNNNYNNNYKKL 351 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.8 bits (49), Expect = 1.9 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 732 IAANLSFRSLYNNHYSY*KLYQNNFN 655 I ++LS ++++NN+ +Y KL N N Sbjct: 314 IISSLSNKTIHNNNNNYKKLQYYNIN 339 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.0 bits (47), Expect = 3.3 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 723 NLSFRSLYNNHYSY*KLYQNNFN 655 N ++++ YNN+Y+ KLY N N Sbjct: 308 NYNYKN-YNNNYNSKKLYYNIIN 329 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 3.3 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 723 NLSFRSLYNNHYSY*KLYQNNFN 655 N ++++ YNN+Y+ KLY N N Sbjct: 319 NYNYKN-YNNNYNSKKLYYNIIN 340 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -3 Query: 732 IAANLSFRSLYNNHYSY*KLYQNNFN 655 I ++LS ++++NN+ Y NN+N Sbjct: 314 IISSLSNKTIHNNNNYNNNNYNNNYN 339 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 5.8 Identities = 7/25 (28%), Positives = 16/25 (64%) Frame = +1 Query: 589 IHYVRQQGLFVSVNQRRINSQFIEI 663 + Y Q+G+ V+ +R+ QF+++ Sbjct: 518 LRYYYQRGILAKVDGQRLVYQFVDV 542 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 307 NSHENNPSAFFFAANQK 257 + H+N+PS F NQK Sbjct: 397 DDHQNSPSIFISDDNQK 413 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 7.7 Identities = 9/41 (21%), Positives = 20/41 (48%) Frame = -3 Query: 741 IGYIAANLSFRSLYNNHYSY*KLYQNNFNELGIDTTLIYGN 619 I ++ N ++ + NN+Y N+ ++ + + YGN Sbjct: 82 ISSLSNNYNYSNYNNNNYKQLCYNINHIEQIPVPVPVYYGN 122 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,524 Number of Sequences: 438 Number of extensions: 4625 Number of successful extensions: 34 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25610547 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -