BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10690 (296 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_02_0115 - 11248021-11248101,11249017-11249118 84 2e-17 05_03_0661 - 16726958-16726966,16727133-16727234 57 3e-09 05_07_0185 - 28257291-28257616,28258202-28258469,28258580-28260061 28 1.1 06_03_0336 + 19671500-19672150,19672681-19673301 27 2.0 08_02_0588 + 19036509-19039235 27 3.5 02_05_0773 + 31654985-31655365,31655486-31655610,31655712-316560... 27 3.5 01_05_0410 + 21914995-21915168,21915268-21915353,21915446-219156... 26 6.0 02_04_0206 + 20916063-20919669,20919816-20920014,20920935-209210... 25 8.0 >01_02_0115 - 11248021-11248101,11249017-11249118 Length = 60 Score = 84.2 bits (199), Expect = 2e-17 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = +2 Query: 23 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLK 178 MAKSKNHT HNQ+ KAH+NGIKKP++ R ST GMDPKFLRNQR+ +K N K Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRQTSTKGMDPKFLRNQRYSRKHNKK 52 >05_03_0661 - 16726958-16726966,16727133-16727234 Length = 36 Score = 56.8 bits (131), Expect = 3e-09 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +2 Query: 23 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMD 130 MAKSKNHT HNQ+ KAH+NGIKKP++ R ST G + Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRQTSTKGFE 36 >05_07_0185 - 28257291-28257616,28258202-28258469,28258580-28260061 Length = 691 Score = 28.3 bits (60), Expect = 1.1 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +2 Query: 86 KKPRKTRHESTLGMDPKFLRNQ-RFCKKG 169 +KP K R L + +F+R+Q + CKKG Sbjct: 454 RKPTKPRQRGKLKLQSQFIRDQNKICKKG 482 >06_03_0336 + 19671500-19672150,19672681-19673301 Length = 423 Score = 27.5 bits (58), Expect = 2.0 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 121 WHGSKIFKESKVLQEG*PEASQATREGG 204 WH FK S+ G PEA+ A EGG Sbjct: 223 WHEINQFKSSEKSLVGMPEAAAAEEEGG 250 >08_02_0588 + 19036509-19039235 Length = 908 Score = 26.6 bits (56), Expect = 3.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 193 ELLGWLQVTLLAKPLIP*KFWIHAKGGFVPG 101 ELLGW QV A ++P + + A F PG Sbjct: 423 ELLGWKQVLAQAANVLPKRRMVSATRRFPPG 453 >02_05_0773 + 31654985-31655365,31655486-31655610,31655712-31656026, 31656145-31656314,31656408-31656751 Length = 444 Score = 26.6 bits (56), Expect = 3.5 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +2 Query: 62 RKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFC 160 ++AHRNG+K T H++ G+ P+ + + + C Sbjct: 121 QRAHRNGVKVLALTDHDTMAGV-PEAIESAKQC 152 >01_05_0410 + 21914995-21915168,21915268-21915353,21915446-21915656, 21915869-21915998,21916740-21916924,21917014-21917145, 21917329-21917433 Length = 340 Score = 25.8 bits (54), Expect = 6.0 Identities = 12/42 (28%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -1 Query: 155 TFDSLKILDPCQGWIRAWSSLAF*Y-HFCELCGFGYDLYDSL 33 TF L ++ CQGW + ++ L+ Y G+ YD + Sbjct: 280 TFQGLALIIRCQGWRQLFAGLSLNYVKVVPSVAIGFTTYDMM 321 >02_04_0206 + 20916063-20919669,20919816-20920014,20920935-20921074, 20921184-20921263,20922759-20922875,20923089-20923136, 20923509-20923601,20923881-20923958,20924114-20924218, 20924543-20925212,20925253-20925350,20925887-20925963, 20926035-20926117,20926208-20926287,20927060-20927139, 20927698-20927743,20928709-20929181,20929234-20929579 Length = 2139 Score = 25.4 bits (53), Expect = 8.0 Identities = 10/25 (40%), Positives = 17/25 (68%), Gaps = 6/25 (24%) Frame = -1 Query: 167 PSCKT------FDSLKILDPCQGWI 111 P+C+T F+S+K+L PC+ W+ Sbjct: 1448 PNCRTEKLYSYFESIKLLFPCEQWM 1472 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,581,399 Number of Sequences: 37544 Number of extensions: 119057 Number of successful extensions: 393 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 386 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 393 length of database: 14,793,348 effective HSP length: 71 effective length of database: 12,127,724 effective search space used: 327448548 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -