BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10683 (613 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 26 0.29 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 25 0.38 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 24 1.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.7 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 22 4.7 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 4.7 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 4.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 4.7 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 4.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 4.7 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 21 6.2 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 21 6.2 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 25.8 bits (54), Expect = 0.29 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 303 WVRHCCRLLSETIPG 259 WV H C+L S+ +PG Sbjct: 493 WVPHSCKLTSKEVPG 507 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/33 (27%), Positives = 20/33 (60%) Frame = -1 Query: 445 KHFEEL*EPIQLLYHSSGLVSHKDSFDNQMHHV 347 +H+EE P+ L +H++ L ++ + D ++ V Sbjct: 411 RHYEENRAPLGLYFHAAWLKNNPEFLDAFLYWV 443 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 25.4 bits (53), Expect = 0.38 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = +1 Query: 277 QQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYP--YVTPTQSYDTTIEWVPTTPQNASI 450 ++ AA PG P P++PR + P +S D+ ++ P P S+ Sbjct: 49 EEEAASPTPGDVPTPSSPRS--ISEDPLNCRDLPNSRCNSRESSDSLVQ--PRCPSGESM 104 Query: 451 LSEKAVV 471 LSE+A + Sbjct: 105 LSERAAL 111 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 23.8 bits (49), Expect = 1.2 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Frame = +1 Query: 253 IQPGYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPY----VTPTQSY 402 I PGY G A + P + P H +PH + +PY V PT ++ Sbjct: 12 IHPGYMDGGAGAGLYEPHVAHRPGLQGLHHSPH--LNHAMHPYHANHVNPTANH 63 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +3 Query: 276 TTTCSNVLPRNHASTNCTSRPCDTTW 353 TTT +T+ T+RP T W Sbjct: 1054 TTTTRRTTTTRPTTTSTTTRPTTTNW 1079 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.8 bits (44), Expect = 4.7 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +1 Query: 91 TEIENV*ISIRKPKLSPTP 147 T++ + +R PK+ PTP Sbjct: 74 TKVHGTTVRVRPPKVYPTP 92 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.8 bits (44), Expect = 4.7 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +1 Query: 91 TEIENV*ISIRKPKLSPTP 147 T++ + +R PK+ PTP Sbjct: 388 TKVHGTTVRVRPPKVYPTP 406 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.7 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +2 Query: 449 YLARRQWWLVMKVTMVVPFGDQVSVPRRSNPRQVMRETFL 568 Y R W L K M+ D++ + R QVM +L Sbjct: 668 YGGRLVWTLPGKTKMIAHLKDKMKIRHRKRWSQVMYMYYL 707 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.7 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +2 Query: 449 YLARRQWWLVMKVTMVVPFGDQVSVPRRSNPRQVMRETFL 568 Y R W L K M+ D++ + R QVM +L Sbjct: 668 YGGRLVWTLPGKTKMIAHLKDKMKIRHRKRWSQVMYMYYL 707 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 4.7 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +1 Query: 91 TEIENV*ISIRKPKLSPTP 147 T++ + +R PK+ PTP Sbjct: 621 TKVHGTTVRVRPPKVYPTP 639 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 4.7 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +1 Query: 91 TEIENV*ISIRKPKLSPTP 147 T++ + +R PK+ PTP Sbjct: 621 TKVHGTTVRVRPPKVYPTP 639 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.7 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +2 Query: 449 YLARRQWWLVMKVTMVVPFGDQVSVPRRSNPRQVMRETFL 568 Y R W L K M+ D++ + R QVM +L Sbjct: 668 YGGRLVWTLPGKTKMIAHLKDKMKIRHRKRWSQVMYMYYL 707 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.7 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +2 Query: 449 YLARRQWWLVMKVTMVVPFGDQVSVPRRSNPRQVMRETFL 568 Y R W L K M+ D++ + R QVM +L Sbjct: 668 YGGRLVWTLPGKTKMIAHLKDKMKIRHRKRWSQVMYMYYL 707 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 124 KPKLSPTPRTNLPIAL 171 KPK+ P+T LP+ L Sbjct: 42 KPKMPLLPKTPLPLTL 57 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.4 bits (43), Expect = 6.2 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = +1 Query: 328 PRGHVTPHGA 357 P G++TPHG+ Sbjct: 250 PTGNITPHGS 259 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,658 Number of Sequences: 336 Number of extensions: 3832 Number of successful extensions: 15 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15561709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -