BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10674 (424 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-... 22 2.5 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 7.5 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 7.5 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 7.5 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 7.5 >M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H40. ). Length = 74 Score = 22.2 bits (45), Expect = 2.5 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 Query: 260 RRWASRERRTGSSAPRCRSICSLEN 334 RRW RE R +A + +LEN Sbjct: 1 RRWDRREARRARTAFTYEQLVALEN 25 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.6 bits (41), Expect = 7.5 Identities = 9/33 (27%), Positives = 13/33 (39%) Frame = -3 Query: 374 PLMHYLRSVLPTPRFPANRCFGILVPMNRSASP 276 P Y+ P PRF + + P+N P Sbjct: 151 PRFRYIGPPTPFPRFIPPNAYRLRPPLNPRFGP 183 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.6 bits (41), Expect = 7.5 Identities = 9/33 (27%), Positives = 13/33 (39%) Frame = -3 Query: 374 PLMHYLRSVLPTPRFPANRCFGILVPMNRSASP 276 P Y+ P PRF + + P+N P Sbjct: 151 PRFRYIGPPTPFPRFIPPNAYRLRPPLNPRFGP 183 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 20.6 bits (41), Expect = 7.5 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -3 Query: 260 LVSWRWPRGPSSLLSR 213 LVSWR P P+ ++++ Sbjct: 1197 LVSWRPPSQPNGVITQ 1212 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 20.6 bits (41), Expect = 7.5 Identities = 9/33 (27%), Positives = 13/33 (39%) Frame = -3 Query: 374 PLMHYLRSVLPTPRFPANRCFGILVPMNRSASP 276 P Y+ P PRF + + P+N P Sbjct: 379 PRFRYIGPPTPFPRFIPPNAYRLRPPLNPRFGP 411 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,249 Number of Sequences: 438 Number of extensions: 1917 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10873896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -