BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10671X (587 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC32H8.13c |mok12||alpha-1,3-glucan synthase Mok12|Schizosacch... 26 3.5 SPBC530.13 |||cyclin Ctk2|Schizosaccharomyces pombe|chr 2|||Manual 25 6.2 >SPBC32H8.13c |mok12||alpha-1,3-glucan synthase Mok12|Schizosaccharomyces pombe|chr 2|||Manual Length = 2352 Score = 26.2 bits (55), Expect = 3.5 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 5/37 (13%) Frame = +1 Query: 328 NLVIYIF--KLSINFWTILVYGMALK---NSLETRVW 423 N+VI+ F ++ IN+W + YG A + N+ T +W Sbjct: 2142 NIVIWFFISQILINYWLAVPYGQAWRFFWNTSNTPLW 2178 >SPBC530.13 |||cyclin Ctk2|Schizosaccharomyces pombe|chr 2|||Manual Length = 325 Score = 25.4 bits (53), Expect = 6.2 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +2 Query: 458 DYIVAYFCSVRFSAETTSV---VCTIAHSNY 541 +Y+V + S++FS+ T S+ VCT A+ Y Sbjct: 148 NYMVKFAKSLKFSSSTASIAWNVCTDAYKTY 178 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,333,165 Number of Sequences: 5004 Number of extensions: 48551 Number of successful extensions: 100 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 254167452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -