BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10671X (587 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7115| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_56830| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 >SB_7115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/50 (26%), Positives = 26/50 (52%) Frame = -1 Query: 410 SRLFFRAIPYTKIVQKLIDNLKIYITRLKMI*VYLAPRTDQYVIETCLKD 261 +R++ YT+I DN +IY+TR + +Y+ + + T +K+ Sbjct: 50 TRIYVTRAEYTRIYVTRADNTRIYVTRAENTRIYVTHADNTQIYVTRIKN 99 >SB_56830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = -2 Query: 472 SDDIIRLTIDSSGLRLAIHEFPGYFS---EPSHTPK 374 S + + LT+ G + +H +PGY+S +PS+T K Sbjct: 120 SSEPLWLTVQKRGGKSGVHFWPGYYSYPEKPSYTEK 155 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,013,929 Number of Sequences: 59808 Number of extensions: 299947 Number of successful extensions: 608 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 606 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1422302661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -