BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10671X (587 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 5.1 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 5.1 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 21 9.0 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 279 DNILIGSRCQIYLNHF 326 +N+L GSR QIY+ + Sbjct: 1425 ENLLCGSRYQIYVTAY 1440 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.8 bits (44), Expect = 5.1 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = +2 Query: 365 FGQFWCMGWL*KIAW 409 FG WC WL W Sbjct: 133 FGDLWCSIWLAVDVW 147 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/32 (25%), Positives = 16/32 (50%) Frame = -2 Query: 553 LIITIITVCYSAYYTGSFS*KPDTTKISDDII 458 ++ + + YS F PDT ++ DD++ Sbjct: 11 VLFNTLHIIYSVAGLKIFEANPDTKRLYDDLL 42 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,531 Number of Sequences: 438 Number of extensions: 3024 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17115420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -