BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10648X (452 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 124 3e-29 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 33 0.084 SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) 33 0.084 SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.26 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 31 0.34 SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) 30 1.0 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 30 1.0 SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) 29 1.8 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 29 1.8 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 1.8 SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) 28 3.1 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_8252| Best HMM Match : rve (HMM E-Value=0.13) 28 3.1 SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) 28 4.2 SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_59069| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.5 SB_25030| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.5 SB_9084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.5 SB_46293| Best HMM Match : Keratin_B2 (HMM E-Value=0.00077) 27 9.6 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 27 9.6 SB_15139| Best HMM Match : Collagen (HMM E-Value=0.27) 27 9.6 SB_257| Best HMM Match : Tetraspannin (HMM E-Value=1.5) 27 9.6 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 124 bits (299), Expect = 3e-29 Identities = 54/66 (81%), Positives = 60/66 (90%) Frame = +3 Query: 255 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPXXRWHRRVNLRQR 434 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK +WH +VN++QR Sbjct: 58 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRKWHTKVNVQQR 117 Query: 435 RAALAA 452 R A+ + Sbjct: 118 RFAVCS 123 Score = 70.9 bits (166), Expect = 5e-13 Identities = 33/59 (55%), Positives = 44/59 (74%) Frame = +1 Query: 82 ARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHK 258 ARP+++V++E E+ LP VFKAPIRPDLVN VH +++KN RQPY V+K AGH+ Sbjct: 2 ARPVITVFNENGESA--GQTTLPAVFKAPIRPDLVNFVHSNIAKNKRQPYAVNKLAGHQ 58 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 33.5 bits (73), Expect = 0.084 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +3 Query: 243 GGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 371 GGW Q WG G+ + R GGG R G +G M GG Sbjct: 258 GGWGQGPGGGWGRGQG-RGMGRGPGGGWGRGSGGGWGRMQGGG 299 >SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) Length = 612 Score = 33.5 bits (73), Expect = 0.084 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 369 HHDTCYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHWF 256 HH CY H Y Y+ H H + R H YP +H++ Sbjct: 20 HHYCCYCHH---RYCYYRHHHYCWYRHHYHYPCYRHYY 54 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -3 Query: 375 YVHHDTCYRRHPDRTYEYHHHGH 307 Y HH CY RH + Y HH H Sbjct: 25 YCHHRYCYYRHHHYCW-YRHHYH 46 >SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 31.9 bits (69), Expect = 0.26 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 354 YRRHPDRTYEYHHHGHAEFGRQHVQYPMIQH 262 Y +HP T+ YH H R H Q+P + H Sbjct: 232 YHQHPQVTHRYHQHPQVTH-RYHQQHPQVTH 261 Score = 31.5 bits (68), Expect = 0.34 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 354 YRRHPDRTYEYHHHGHAEFGRQHVQYPMIQH 262 Y +HP T+ YHH H + ++ Q+P + H Sbjct: 413 YHQHPQLTHRYHHQ-HPQVIHRYHQHPQVTH 442 Score = 27.5 bits (58), Expect = 5.5 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -3 Query: 354 YRRHPDRTYEYHHHGHAEFGRQHVQYPMIQH 262 Y +HP T+ YH R Q+P + H Sbjct: 242 YHQHPQVTHRYHQQHPQVTHRYQYQHPQVTH 272 Score = 27.1 bits (57), Expect = 7.3 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 345 HPDRTYEYHHHGHAEFGRQHVQYPMIQH 262 HP T+ YH H R H Q+P + H Sbjct: 406 HPQVTHRYHQHPQLTH-RYHHQHPQVIH 432 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 31.5 bits (68), Expect = 0.34 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 369 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 286 HH RH R + +HHH H E+ R+H Sbjct: 325 HHQRHRHRHRHR-HRHHHHHHHEYNRRH 351 >SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) Length = 839 Score = 29.9 bits (64), Expect = 1.0 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 369 HHDTCYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHWFVTSLL 241 HH + RH R + YHHH + H +P FVT+++ Sbjct: 570 HHHLHHHRHHHRHHHYHHHHYP----HHHHHPCTIIIFVTTII 608 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 29.9 bits (64), Expect = 1.0 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +3 Query: 243 GGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 371 GGW + S WG G R +GGG R G +G GG Sbjct: 6 GGWGRGSGGGWGQGPG-GGWGRGQGGGMGRGPGGGWGRGSGGG 47 Score = 29.1 bits (62), Expect = 1.8 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +3 Query: 243 GGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 371 GGW + S WG R++GGG R G +G M GG Sbjct: 38 GGWGRGSGGGWG---------RMQGGGMGRGPGGGWGRMQGGG 71 >SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.5 bits (63), Expect = 1.4 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 378 TYVHHDTCYRRHPDRTYEYHHHGHA 304 TY H DT R+HPD H HA Sbjct: 123 TYTHQDTQMRKHPDTQIYVHAPRHA 147 >SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) Length = 694 Score = 29.1 bits (62), Expect = 1.8 Identities = 9/35 (25%), Positives = 14/35 (40%) Frame = -3 Query: 381 RTYVHHDTCYRRHPDRTYEYHHHGHAEFGRQHVQY 277 R + HH + H + +HHH H H + Sbjct: 209 RHHQHHQHHHHHHHQHNHHHHHHNHHHHHHHHYHH 243 Score = 26.6 bits (56), Expect = 9.6 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -3 Query: 369 HHDTCYRRHPDRTYEYHHHGH 307 HH + H + YHHH H Sbjct: 229 HHHNHHHHHHHHYHHYHHHHH 249 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 29.1 bits (62), Expect = 1.8 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 5/47 (10%) Frame = +3 Query: 210 QELEAALLREQGGWSQTSAESWGTGRA----VARIPR-VRGGGTHRS 335 + E+AL E+ W+Q AES T RA +AR+ R GT RS Sbjct: 3432 EHAESALAAERAQWAQEKAESQNTIRAANEEIARLKEDARKAGTERS 3478 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 29.1 bits (62), Expect = 1.8 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 258 TSAESWGTGRAVARIPR-VRGGGTHRSGQGAFGNMCRGGR 374 T +E +G ++ R PR RGGG G G G RGGR Sbjct: 983 TPSEPSSSGSSIVRRPRRRRGGGGGGGGGGGGGGGRRGGR 1022 >SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) Length = 193 Score = 28.3 bits (60), Expect = 3.1 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 369 HHDTCYRRHPDRTYEYHHH 313 HH YR H + Y +HHH Sbjct: 96 HHHQHYRHHRHQHYRHHHH 114 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -1 Query: 149 GRGLAAPCTVSLFSEYTDTKGRATDRLI 66 G+GL C+V+L S Y T+G+ RL+ Sbjct: 3163 GKGLTTWCSVNLDSVYLSTEGKEVYRLV 3190 >SB_8252| Best HMM Match : rve (HMM E-Value=0.13) Length = 264 Score = 28.3 bits (60), Expect = 3.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 375 YVHHDTCYRRHPDRTYEYHHHGH 307 Y HH +RR R + +HHH H Sbjct: 233 YHHHHHHHRRRRRRRHHHHHHHH 255 >SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) Length = 1779 Score = 27.9 bits (59), Expect = 4.2 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 369 HHDTCYRRHPDRTYEYHHHGH 307 HH + RH DR + + HH H Sbjct: 340 HHRNKHYRHHDRNHHHRHHHH 360 >SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 27.9 bits (59), Expect = 4.2 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 357 CYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQH 262 CY + + + YHHH H H Q+ H Sbjct: 246 CYHKLKNPRHRYHHHHHHHHQHNHHQHHHHHH 277 Score = 27.9 bits (59), Expect = 4.2 Identities = 10/47 (21%), Positives = 22/47 (46%) Frame = -3 Query: 381 RTYVHHDTCYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHWFVTSLL 241 R + HH ++ + + + +HHH H H Q+ H + +++ Sbjct: 256 RYHHHHHHHHQHNHHQHHHHHHHHHHNHHHHHQQHHHHHHHHIINII 302 >SB_59069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 664 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -3 Query: 378 TYVHHDTCYRRHPDRTYEYHHHGHA 304 TY H DT +HPD H HA Sbjct: 323 TYTHQDTQMHKHPDTQMYVHAPRHA 347 >SB_25030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 27.5 bits (58), Expect = 5.5 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = -3 Query: 333 TYEYHHHGHAEFGRQHVQYPMI-QHWFVTSLLAHAVGLP-RVLGHRNVN 193 +Y++HHHG E Q V I + W L +H P RV+G ++ Sbjct: 21 SYQWHHHGTGETDDQPVTTTRITRTWVNRRLNSHRTIKPSRVIGRAQIH 69 >SB_9084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.5 bits (58), Expect = 5.5 Identities = 10/40 (25%), Positives = 16/40 (40%) Frame = -3 Query: 369 HHDTCYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHWFVT 250 HH + H +++ HH H QH + H +T Sbjct: 6 HHHHDHHHHDHHHHDHQHHDHQHHDHQHHDHHHHDHHHMT 45 >SB_46293| Best HMM Match : Keratin_B2 (HMM E-Value=0.00077) Length = 677 Score = 26.6 bits (56), Expect = 9.6 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -2 Query: 193 HH*PGPDGWAP*TRTGGAWLHPAPSHSSLSTPT 95 HH W T+T W HP + ++L PT Sbjct: 117 HHTKTQANWYHPTKTQANWYHPTKTQANLYHPT 149 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 26.6 bits (56), Expect = 9.6 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +3 Query: 279 TGRAVARIPR-VRGGGTHRSGQGAFGNMCRGGR 374 +G ++ R PR RGGG G G G RGGR Sbjct: 501 SGSSIVRRPRRRRGGGGGGGGGGGGGGGGRGGR 533 >SB_15139| Best HMM Match : Collagen (HMM E-Value=0.27) Length = 562 Score = 26.6 bits (56), Expect = 9.6 Identities = 18/48 (37%), Positives = 20/48 (41%) Frame = +3 Query: 234 REQGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRM 377 R GW S G VA RV GG SG G + RGGR+ Sbjct: 228 RVASGWRVASGGRVARGGCVASGGRVASGGRVASG----GRVARGGRV 271 >SB_257| Best HMM Match : Tetraspannin (HMM E-Value=1.5) Length = 237 Score = 26.6 bits (56), Expect = 9.6 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 354 YRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHW 259 +R+H +R +HHH H +P H+ Sbjct: 190 HRQHYNRHRRHHHHHRHRHHHHHPNHPYSHHY 221 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,410,624 Number of Sequences: 59808 Number of extensions: 274329 Number of successful extensions: 905 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 699 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 841 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 908427626 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -