BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10645X (326 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_356| Best HMM Match : zf-C3HC4 (HMM E-Value=0.06) 40 4e-04 SB_35765| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 8e-04 SB_59287| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 8e-04 SB_4770| Best HMM Match : Exo_endo_phos (HMM E-Value=0.031) 39 0.001 SB_25871| Best HMM Match : SLH (HMM E-Value=1.1) 38 0.001 SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) 38 0.001 SB_56531| Best HMM Match : SLH (HMM E-Value=1.1) 38 0.001 SB_39284| Best HMM Match : WW (HMM E-Value=7.9) 38 0.001 SB_38574| Best HMM Match : WW (HMM E-Value=4.9) 38 0.001 SB_54439| Best HMM Match : SNF (HMM E-Value=0) 38 0.002 SB_37723| Best HMM Match : RVT_1 (HMM E-Value=0.054) 38 0.002 SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.002 SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18) 38 0.003 SB_29609| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_25444| Best HMM Match : SH2 (HMM E-Value=6.4) 38 0.003 SB_11072| Best HMM Match : SH2 (HMM E-Value=6.4) 38 0.003 SB_9383| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_8006| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) 38 0.003 SB_5462| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_51865| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_47163| Best HMM Match : SH2 (HMM E-Value=6.4) 38 0.003 SB_43796| Best HMM Match : SH2 (HMM E-Value=6.4) 38 0.003 SB_33864| Best HMM Match : WD40 (HMM E-Value=2.1) 38 0.003 SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) 38 0.003 SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) 38 0.003 SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022) 37 0.003 SB_23846| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.003 SB_23375| Best HMM Match : PCI (HMM E-Value=9.5) 37 0.003 SB_16546| Best HMM Match : SH2 (HMM E-Value=6.4) 37 0.003 SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) 37 0.003 SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) 37 0.003 SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) 37 0.003 SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.003 SB_57709| Best HMM Match : RVT_1 (HMM E-Value=0.00081) 37 0.004 SB_5514| Best HMM Match : TB (HMM E-Value=4.3) 37 0.004 SB_9149| Best HMM Match : Lipase_GDSL (HMM E-Value=0.51) 37 0.004 SB_20315| Best HMM Match : RVT_1 (HMM E-Value=1.4e-21) 36 0.006 SB_59170| Best HMM Match : RVT_1 (HMM E-Value=0.13) 36 0.008 SB_27289| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.008 SB_15890| Best HMM Match : ArsC (HMM E-Value=0.94) 36 0.008 SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.010 SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.010 SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.014 SB_7179| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.014 SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.018 SB_9316| Best HMM Match : SH2 (HMM E-Value=6.4) 35 0.018 SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) 35 0.018 SB_4872| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.018 SB_53921| Best HMM Match : Viral_P18 (HMM E-Value=2.6) 34 0.024 SB_52416| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.024 SB_36270| Best HMM Match : Viral_P18 (HMM E-Value=4.9) 34 0.024 SB_29973| Best HMM Match : RVT_1 (HMM E-Value=5.2e-21) 34 0.024 SB_23599| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.024 SB_55213| Best HMM Match : Viral_P18 (HMM E-Value=2.6) 34 0.024 SB_52244| Best HMM Match : RVT_1 (HMM E-Value=9.5e-20) 34 0.024 SB_43560| Best HMM Match : DUF633 (HMM E-Value=4.4) 34 0.024 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.031 SB_38681| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 34 0.031 SB_18090| Best HMM Match : RVT_1 (HMM E-Value=0.59) 34 0.031 SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14) 34 0.031 SB_16275| Best HMM Match : RVT_1 (HMM E-Value=1.7e-16) 34 0.031 SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.031 SB_46063| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00015) 33 0.041 SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.041 SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 33 0.041 SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 33 0.041 SB_49650| Best HMM Match : RVT_1 (HMM E-Value=1.3) 33 0.055 SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.055 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.055 SB_30875| Best HMM Match : Rubredoxin (HMM E-Value=1.6) 33 0.072 SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 33 0.072 SB_1670| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.072 SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) 33 0.072 SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.096 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.096 SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) 32 0.096 SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.096 SB_9954| Best HMM Match : SLH (HMM E-Value=1.1) 32 0.096 SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.13 SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.13 SB_6318| Best HMM Match : RVT_1 (HMM E-Value=0.72) 32 0.13 SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) 32 0.13 SB_18416| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.17 SB_10126| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.17 SB_40765| Best HMM Match : DX (HMM E-Value=1.4) 31 0.22 SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21) 31 0.22 SB_59555| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.29 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.29 SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) 31 0.29 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 31 0.29 SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) 31 0.29 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 31 0.29 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 31 0.29 SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.29 SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) 31 0.29 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.29 SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.29 SB_35861| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.29 SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.29 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.29 SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.29 SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.39 SB_6579| Best HMM Match : RVT_1 (HMM E-Value=2.5e-14) 30 0.51 SB_45899| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) 30 0.51 SB_34939| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.51 SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) 29 0.68 SB_24320| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.68 SB_12986| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.68 SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.68 SB_7040| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.68 SB_51996| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.68 SB_51096| Best HMM Match : Baculo_ME53 (HMM E-Value=5.6) 29 0.68 SB_41403| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.68 SB_28070| Best HMM Match : RRM_1 (HMM E-Value=1.3e-07) 29 0.68 SB_6674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.68 SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) 29 0.68 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.89 SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) 29 0.89 SB_43127| Best HMM Match : DUF1690 (HMM E-Value=2.2) 29 0.89 SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) 29 0.89 SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 29 0.89 SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) 29 0.89 SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) 29 0.89 SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) 29 0.89 SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.89 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.89 SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) 29 0.89 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.89 SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) 29 0.89 SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.89 SB_18362| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.89 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 29 0.89 SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.89 SB_16338| Best HMM Match : PHD (HMM E-Value=3.8e-08) 29 0.89 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.89 SB_8726| Best HMM Match : Pox_F16 (HMM E-Value=5.2) 29 0.89 SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 1.2 SB_56417| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 29 1.2 SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 29 1.2 SB_35414| Best HMM Match : NinE (HMM E-Value=8.4) 29 1.2 SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) 29 1.2 SB_24260| Best HMM Match : Rotavirus_VP7 (HMM E-Value=7.7) 29 1.2 SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 1.2 SB_7633| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 1.2 SB_58494| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) 29 1.2 SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) 29 1.2 SB_53437| Best HMM Match : DUF1126 (HMM E-Value=5.1) 29 1.2 SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 29 1.2 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 1.2 SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) 29 1.2 SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 1.2 SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 1.2 SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 1.2 SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) 29 1.2 SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 29 1.2 SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 1.2 SB_17216| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_8964| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_4883| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_54561| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.6 SB_47925| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.6 SB_42199| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.6 SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) 28 1.6 SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) 28 1.6 SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.6 SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1) 28 1.6 SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.6 SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.1 SB_42059| Best HMM Match : RVT_1 (HMM E-Value=0.0011) 28 2.1 SB_56913| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.1 SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) 28 2.1 SB_31184| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.7 SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.7 SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.7 SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.7 SB_32094| Best HMM Match : RVT_1 (HMM E-Value=1.9e-12) 27 2.7 SB_15386| Best HMM Match : CSE2 (HMM E-Value=0.18) 27 2.7 SB_55856| Best HMM Match : TPR_2 (HMM E-Value=4.1e-14) 27 3.6 SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) 27 3.6 SB_45989| Best HMM Match : TFIIE_alpha (HMM E-Value=5) 27 3.6 SB_45959| Best HMM Match : DUF1091 (HMM E-Value=3.6) 27 3.6 SB_36728| Best HMM Match : ArsD (HMM E-Value=1.6) 27 3.6 SB_32837| Best HMM Match : RVT_1 (HMM E-Value=8.3e-17) 27 3.6 SB_31881| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.6 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 27 3.6 SB_27763| Best HMM Match : VapD_N (HMM E-Value=10) 27 3.6 SB_47944| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.6 SB_39804| Best HMM Match : VapD_N (HMM E-Value=10) 27 3.6 SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) 27 3.6 SB_58879| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_49069| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) 27 4.8 SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_39569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_38350| Best HMM Match : OCIA (HMM E-Value=6.7) 27 4.8 SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) 27 4.8 SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) 27 4.8 SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_21287| Best HMM Match : Lectin_C (HMM E-Value=3.1) 27 4.8 SB_16738| Best HMM Match : DUF217 (HMM E-Value=7.8) 27 4.8 SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) 27 4.8 SB_8874| Best HMM Match : PhaG_MnhG_YufB (HMM E-Value=2.4) 27 4.8 SB_5302| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_270| Best HMM Match : PHD (HMM E-Value=0.0037) 27 4.8 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 27 4.8 SB_44566| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_35350| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) 27 4.8 SB_19421| Best HMM Match : Ribosomal_L36 (HMM E-Value=0.85) 27 4.8 SB_58751| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.3 SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) 26 6.3 SB_53749| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.3 SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) 26 6.3 SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.3 SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 26 6.3 SB_33786| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.3 SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) 26 6.3 SB_18309| Best HMM Match : Exo_endo_phos (HMM E-Value=2.3e-09) 26 6.3 SB_17007| Best HMM Match : VWA (HMM E-Value=4.6e-06) 26 6.3 SB_12291| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-09) 26 6.3 SB_10379| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.3 SB_2841| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.3 SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 26 6.3 SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) 26 6.3 SB_15410| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.3 SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) 26 6.3 SB_11192| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.3 SB_11114| Best HMM Match : UPF0203 (HMM E-Value=9.6) 26 6.3 SB_8972| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.3 SB_50918| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.3 SB_39420| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.3 SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.3 SB_58983| Best HMM Match : Integrin_alpha (HMM E-Value=2.7) 26 8.3 SB_30161| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.3 SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) 26 8.3 >SB_356| Best HMM Match : zf-C3HC4 (HMM E-Value=0.06) Length = 587 Score = 40.3 bits (90), Expect = 4e-04 Identities = 28/93 (30%), Positives = 51/93 (54%), Gaps = 4/93 (4%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAV 210 RLY + + K+ + + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 66 RLYALRVLKKCGLDAKELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIAF 125 Query: 211 GAPLVR-EER*PTRRPSLESIQKYMKS--TSER 300 P++R R + P ES + ++ T+ER Sbjct: 126 --PVLRHRSRHHAKIPCTESETTHAENCGTAER 156 >SB_35765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 39.1 bits (87), Expect = 8e-04 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 207 RLY + + K+ + +T+Y++ IR V+ YAS VFA+ D L+++Q R ++A Sbjct: 44 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAVFANLPNYLSDALENVQRRALKIA 102 >SB_59287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 39.1 bits (87), Expect = 8e-04 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 207 RLY + + K+ + +T+Y++ IR V+ YAS VFA+ D L+++Q R ++A Sbjct: 44 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAVFANLPNYLSDALENVQRRALKIA 102 >SB_4770| Best HMM Match : Exo_endo_phos (HMM E-Value=0.031) Length = 599 Score = 38.7 bits (86), Expect = 0.001 Identities = 21/55 (38%), Positives = 32/55 (58%) Frame = +1 Query: 55 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 219 KR +S N + +Y++ +R + YASVVFA R D+L+ +Q C LA+ P Sbjct: 463 KRCGVSTDNIIVVYRSLVRSTLEYASVVFADLPRYLSDSLERVQK--CTLAIIYP 515 >SB_25871| Best HMM Match : SLH (HMM E-Value=1.1) Length = 172 Score = 38.3 bits (85), Expect = 0.001 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +1 Query: 34 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 192 RLY + KR +S N + +Y++ +R + YASVVFA R D+L+ +Q R Sbjct: 7 RLYAIRQLKRCGVSTDNIIVVYRSLVRSTLEYASVVFADLPRYLSDSLERVQKR 60 >SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) Length = 554 Score = 38.3 bits (85), Expect = 0.001 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +1 Query: 34 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 192 RLY + KR +S N + +Y++ +R + YASVVFA R D+L+ +Q R Sbjct: 389 RLYAIRQLKRCGVSTDNIIVVYRSLVRSTLEYASVVFADLPRYLSDSLERVQKR 442 >SB_56531| Best HMM Match : SLH (HMM E-Value=1.1) Length = 151 Score = 38.3 bits (85), Expect = 0.001 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +1 Query: 34 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 192 RLY + KR +S N + +Y++ +R + YASVVFA R D+L+ +Q R Sbjct: 7 RLYAIRQLKRCGVSTDNIIVVYRSLVRSTLKYASVVFADLPRYLSDSLERVQKR 60 >SB_39284| Best HMM Match : WW (HMM E-Value=7.9) Length = 251 Score = 38.3 bits (85), Expect = 0.001 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 207 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 109 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLFDALENVQRRALKIA 167 >SB_38574| Best HMM Match : WW (HMM E-Value=4.9) Length = 256 Score = 38.3 bits (85), Expect = 0.001 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 207 RLY + + K+ + +T+Y++ IR V+ YAS+ FA+ D L+++Q R ++A Sbjct: 114 RLYALRVLKKCGLDAIELITVYRSPIRSVIEYASIAFANLQNYLSDVLENVQRRVLKIA 172 >SB_54439| Best HMM Match : SNF (HMM E-Value=0) Length = 701 Score = 37.9 bits (84), Expect = 0.002 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 207 RLY + I K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 640 RLYALRILKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 698 >SB_37723| Best HMM Match : RVT_1 (HMM E-Value=0.054) Length = 596 Score = 37.9 bits (84), Expect = 0.002 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAV 210 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 426 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIAF 485 Query: 211 GA 216 A Sbjct: 486 PA 487 >SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 37.9 bits (84), Expect = 0.002 Identities = 14/55 (25%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = +1 Query: 46 MICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHI-DTLQSLQSRFCRLA 207 ++ KR+++ + + + Y TC+RP++ Y + +F H ++ + L+ +Q R +A Sbjct: 625 VLLKRARVPVSDIIGFYNTCVRPILEYCAPLFHHTIPAYVKEDLEHIQKRALSIA 679 >SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18) Length = 552 Score = 37.5 bits (83), Expect = 0.003 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +1 Query: 49 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ Sbjct: 409 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARV 462 >SB_29609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 37.5 bits (83), Expect = 0.003 Identities = 14/50 (28%), Positives = 28/50 (56%) Frame = +1 Query: 55 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 K+ +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ Sbjct: 66 KKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARV 115 >SB_25444| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 252 Score = 37.5 bits (83), Expect = 0.003 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +1 Query: 49 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ Sbjct: 109 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARV 162 >SB_11072| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 228 Score = 37.5 bits (83), Expect = 0.003 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +1 Query: 49 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ Sbjct: 160 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARV 213 >SB_9383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 37.5 bits (83), Expect = 0.003 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 207 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 161 RLYALRVLKKCGLDAIELITVYRSFIRSVIEYASAAFANLPNCLCDDLENVQRRALKIA 219 >SB_8006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 37.5 bits (83), Expect = 0.003 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 207 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 81 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 139 >SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 323 Score = 37.5 bits (83), Expect = 0.003 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +1 Query: 49 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ Sbjct: 186 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARV 239 >SB_5462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 37.5 bits (83), Expect = 0.003 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 207 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 195 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASATFANLPNYLSDALENVQRRTLKIA 253 >SB_51865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 37.5 bits (83), Expect = 0.003 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 207 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 181 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 239 >SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 893 Score = 37.5 bits (83), Expect = 0.003 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +1 Query: 49 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ Sbjct: 823 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARV 876 >SB_47163| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 172 Score = 37.5 bits (83), Expect = 0.003 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +1 Query: 49 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ Sbjct: 72 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARV 125 >SB_43796| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 352 Score = 37.5 bits (83), Expect = 0.003 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +1 Query: 49 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ Sbjct: 294 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARV 347 >SB_33864| Best HMM Match : WD40 (HMM E-Value=2.1) Length = 397 Score = 37.5 bits (83), Expect = 0.003 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 207 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 255 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 313 >SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) Length = 309 Score = 37.5 bits (83), Expect = 0.003 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +1 Query: 49 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ Sbjct: 207 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARV 260 >SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) Length = 675 Score = 37.5 bits (83), Expect = 0.003 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +1 Query: 49 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R+ Sbjct: 605 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARV 658 >SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022) Length = 270 Score = 37.1 bits (82), Expect = 0.003 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +1 Query: 49 ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 + KR+K L + Y + I+P++ Y ++V+ + HID + Q R R Sbjct: 220 LLKRTKKFLSARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMIKFQKRCAR 270 >SB_23846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 37.1 bits (82), Expect = 0.003 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 207 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+ +Q R ++A Sbjct: 41 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALEDVQRRALKIA 99 >SB_23375| Best HMM Match : PCI (HMM E-Value=9.5) Length = 208 Score = 37.1 bits (82), Expect = 0.003 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 207 RLY + + K+ + + +T+Y++ IR V+ YAS FA+ D L+ +Q R ++A Sbjct: 66 RLYALRVLKKCGLDVIELITVYRSLIRSVIEYASEAFANLPNYLSDALEKVQRRALKIA 124 >SB_16546| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 124 Score = 37.1 bits (82), Expect = 0.003 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +1 Query: 49 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R Sbjct: 72 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCAR 124 >SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) Length = 277 Score = 37.1 bits (82), Expect = 0.003 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +1 Query: 49 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 + KR+K +SL+ + Y I+P++ Y ++V+ + HID + Q R R+ Sbjct: 207 LLKRTKKFLSLKARTLFYHALIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARV 260 >SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) Length = 228 Score = 37.1 bits (82), Expect = 0.003 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +1 Query: 49 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R Sbjct: 176 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCAR 228 >SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 252 Score = 37.1 bits (82), Expect = 0.003 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +1 Query: 49 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R R Sbjct: 72 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCAR 124 >SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 37.1 bits (82), Expect = 0.003 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 1/85 (1%) Frame = +1 Query: 55 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHI-DTLQSLQSRFCRLAVGAPLVRE 231 KR+ + ++ + Y TCIRPV YA VF H ++ + L+ Q R R+ PL+ Sbjct: 1213 KRANIKVKELLLFYLTCIRPVTEYACPVFHHCLPQYLSNDLERCQKRALRIIY--PLLSY 1270 Query: 232 ER*PTRRPSLESIQKYMKSTSERYF 306 E LE++ + S++ F Sbjct: 1271 EC-ALSTAGLETLHNRRATISQKLF 1294 >SB_57709| Best HMM Match : RVT_1 (HMM E-Value=0.00081) Length = 754 Score = 36.7 bits (81), Expect = 0.004 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAV 210 +LY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 557 KLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIAF 616 Query: 211 GA 216 A Sbjct: 617 PA 618 >SB_5514| Best HMM Match : TB (HMM E-Value=4.3) Length = 243 Score = 36.7 bits (81), Expect = 0.004 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 207 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 44 RLYALRVLKKWGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 102 >SB_9149| Best HMM Match : Lipase_GDSL (HMM E-Value=0.51) Length = 604 Score = 36.7 bits (81), Expect = 0.004 Identities = 15/56 (26%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Frame = +1 Query: 49 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAV 210 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q + R+ + Sbjct: 436 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKQCARVII 491 >SB_20315| Best HMM Match : RVT_1 (HMM E-Value=1.4e-21) Length = 479 Score = 36.3 bits (80), Expect = 0.006 Identities = 18/59 (30%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 207 RLY + + K+ + +T+Y++ IR V+ Y+S FA+ D L+++Q R ++A Sbjct: 364 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYSSAAFANLPNYLSDALENVQRRALKIA 422 >SB_59170| Best HMM Match : RVT_1 (HMM E-Value=0.13) Length = 679 Score = 35.9 bits (79), Expect = 0.008 Identities = 18/58 (31%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 RLY + K+S +S N + +Y + +RPV+ YAS V++ ++ ++S+Q + R+ Sbjct: 537 RLYAIRALKKSGLSSNNLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 594 >SB_27289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 35.9 bits (79), Expect = 0.008 Identities = 17/55 (30%), Positives = 35/55 (63%), Gaps = 2/55 (3%) Frame = +1 Query: 34 RLYPMIC-KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHI-DTLQSLQSR 192 RLY ++ +R+++ ++ + Y + IRPV+ Y + VF HA +++ D ++ +Q R Sbjct: 469 RLYFIVSLRRARVPTKDIIDFYCSAIRPVLEYCAAVFHHALPSYLSDDIERVQKR 523 >SB_15890| Best HMM Match : ArsC (HMM E-Value=0.94) Length = 310 Score = 35.9 bits (79), Expect = 0.008 Identities = 18/58 (31%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 RLY + K+S +S N + +Y + +RPV+ YAS V++ ++ ++S+Q + R+ Sbjct: 168 RLYAIRALKKSGLSSNNLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 225 >SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 35.5 bits (78), Expect = 0.010 Identities = 22/58 (37%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Frame = +1 Query: 34 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 RLY + KR +S + V +Y + IR V+ YASVVFA+ + ++L+++Q R R+ Sbjct: 690 RLYALRQLKRCGVSPVDIVLVYCSLIRSVIEYASVVFANLPQYLANSLEAIQKRALRI 747 >SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 35.5 bits (78), Expect = 0.010 Identities = 18/59 (30%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 207 RLY + + K+ + +T+Y++ IR V+ YAS FA+ + L+++Q R ++A Sbjct: 963 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSNALENVQRRALKIA 1021 >SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 35.1 bits (77), Expect = 0.014 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +1 Query: 49 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + + R R+ Sbjct: 204 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGLTKKQHIDYMVKFEKRCARV 257 >SB_7179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 35.1 bits (77), Expect = 0.014 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +1 Query: 34 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 192 RLY + KR +S + + +Y++ +R + YASVVFA R D+L +Q R Sbjct: 7 RLYAIRQLKRCGVSTDDIIVVYRSLVRSTLEYASVVFADLPRYPSDSLVRVQKR 60 >SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 764 Score = 34.7 bits (76), Expect = 0.018 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +1 Query: 34 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 192 RLY + KR +S + + +Y++ +R + YASVVFA R D+L +Q R Sbjct: 615 RLYAIRQLKRCGVSTDDIIVVYRSLVRSTLEYASVVFADLPRYLSDSLVRVQKR 668 >SB_9316| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 169 Score = 34.7 bits (76), Expect = 0.018 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +1 Query: 49 ICKRSK--MSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 + KR+K +SL+ + Y + I+P++ Y ++V+ + HID + Q R+ Sbjct: 72 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKGCARV 125 >SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) Length = 756 Score = 34.7 bits (76), Expect = 0.018 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +1 Query: 34 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 192 RLY + KR +S + + +Y++ +R + YASVVFA R D+L +Q R Sbjct: 131 RLYAIRQLKRCGVSTDDIIVVYRSLVRSTLEYASVVFADLPRYLSDSLVRVQKR 184 >SB_4872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 403 Score = 34.7 bits (76), Expect = 0.018 Identities = 15/51 (29%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Frame = +1 Query: 55 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHI-DTLQSLQSRFCRL 204 KRS ++ V+ ++TC+RP+ YA V+ + +++ ++L+ +Q R R+ Sbjct: 276 KRSGLAKSGLVSFFRTCVRPITEYACPVYHDSLPSYLSNSLEQVQRRALRI 326 >SB_53921| Best HMM Match : Viral_P18 (HMM E-Value=2.6) Length = 322 Score = 34.3 bits (75), Expect = 0.024 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 RLY + + K++ +S+ + T+Y IR V+ YAS V+A + L+S+Q R ++ Sbjct: 181 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 238 >SB_52416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 34.3 bits (75), Expect = 0.024 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 RLY + + K++ +S+ + T+Y IR V+ YAS V+A + L+S+Q R ++ Sbjct: 310 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 367 >SB_36270| Best HMM Match : Viral_P18 (HMM E-Value=4.9) Length = 283 Score = 34.3 bits (75), Expect = 0.024 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 RLY + + K++ +S+ + T+Y IR V+ YAS V+A + L+S+Q R ++ Sbjct: 181 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 238 >SB_29973| Best HMM Match : RVT_1 (HMM E-Value=5.2e-21) Length = 499 Score = 34.3 bits (75), Expect = 0.024 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 RLY + + K++ +S+ + T+Y IR V+ YAS V+A + L+S+Q R ++ Sbjct: 401 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 458 >SB_23599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 34.3 bits (75), Expect = 0.024 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 RLY + + K++ +S+ + T+Y IR V+ YAS V+A + L+S+Q R ++ Sbjct: 143 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 200 >SB_55213| Best HMM Match : Viral_P18 (HMM E-Value=2.6) Length = 371 Score = 34.3 bits (75), Expect = 0.024 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 RLY + + K++ +S+ + T+Y IR V+ YAS V+A + L+S+Q R ++ Sbjct: 181 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 238 >SB_52244| Best HMM Match : RVT_1 (HMM E-Value=9.5e-20) Length = 523 Score = 34.3 bits (75), Expect = 0.024 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 RLY + + K++ +S+ + T+Y IR V+ YAS V+A + L+S+Q R ++ Sbjct: 382 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 439 >SB_43560| Best HMM Match : DUF633 (HMM E-Value=4.4) Length = 284 Score = 34.3 bits (75), Expect = 0.024 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 RLY + + K++ +S+ + T+Y IR V+ YAS V+A + L+S+Q R ++ Sbjct: 143 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 200 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 33.9 bits (74), Expect = 0.031 Identities = 17/58 (29%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 RLY + K+S +S + + +Y + +RPV+ YAS V++ ++ ++S+Q + R+ Sbjct: 1019 RLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 1076 >SB_38681| Best HMM Match : RVT_1 (HMM E-Value=0.0082) Length = 559 Score = 33.9 bits (74), Expect = 0.031 Identities = 17/58 (29%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 RLY + K+S +S + + +Y + +RPV+ YAS V++ ++ ++S+Q + R+ Sbjct: 417 RLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 474 >SB_18090| Best HMM Match : RVT_1 (HMM E-Value=0.59) Length = 427 Score = 33.9 bits (74), Expect = 0.031 Identities = 17/58 (29%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 RLY + K+S +S + + +Y + +RPV+ YAS V++ ++ ++S+Q + R+ Sbjct: 285 RLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 342 >SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14) Length = 595 Score = 33.9 bits (74), Expect = 0.031 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = +1 Query: 85 VTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 207 +T+Y++ IR V+ YAS FA+ D L+++Q R ++A Sbjct: 480 ITVYRSLIRSVIEYASAAFANFPNYLSDALENVQRRALKIA 520 >SB_16275| Best HMM Match : RVT_1 (HMM E-Value=1.7e-16) Length = 409 Score = 33.9 bits (74), Expect = 0.031 Identities = 17/58 (29%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 RLY + K+S +S + + +Y + +RPV+ YAS V++ ++ ++S+Q + R+ Sbjct: 293 RLYAIGALKKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 350 >SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 33.9 bits (74), Expect = 0.031 Identities = 17/58 (29%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 RLY + K+S +S + + +Y + +RPV+ YAS V++ ++ ++S+Q + R+ Sbjct: 586 RLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 643 >SB_46063| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00015) Length = 798 Score = 33.5 bits (73), Expect = 0.041 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Frame = +1 Query: 34 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAV 210 RLY + KR +S + + +Y++ +R + YASVVFA R D+L ++ L++ Sbjct: 731 RLYAIRQLKRCGVSTDDIIVVYRSLVRSTLEYASVVFADLPRYLSDSLAESRNAPSPLSI 790 Query: 211 GAPLVRE 231 A + R+ Sbjct: 791 RAWITRK 797 >SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4232 Score = 33.5 bits (73), Expect = 0.041 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +1 Query: 55 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 192 K+ + + + VT+Y + IRP+ YASV+F++ + L+ +Q R Sbjct: 4157 KKCGVPVEDMVTVYCSLIRPITEYASVIFSNIPCYLSEALEKIQRR 4202 >SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 541 Score = 33.5 bits (73), Expect = 0.041 Identities = 19/50 (38%), Positives = 31/50 (62%) Frame = +1 Query: 55 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 KR +S + V +Y + IR V+ YASVVFA+ + + L+++Q R R+ Sbjct: 416 KRCGVSPVDIVLVYCSLIRSVIEYASVVFANLPQYLANYLEAIQKRALRI 465 >SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 476 Score = 33.5 bits (73), Expect = 0.041 Identities = 19/50 (38%), Positives = 31/50 (62%) Frame = +1 Query: 55 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 KR +S + V +Y + IR V+ YASVVFA+ + + L+++Q R R+ Sbjct: 351 KRCGVSPVDIVLVYCSLIRSVIEYASVVFANLPQYLANYLEAIQKRALRI 400 >SB_49650| Best HMM Match : RVT_1 (HMM E-Value=1.3) Length = 379 Score = 33.1 bits (72), Expect = 0.055 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +1 Query: 34 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 192 RLY + KR S + + +Y++ +R + YASVVFA D+L+ +Q R Sbjct: 235 RLYAIRQLKRCGASTDDIIVVYRSLVRSTLEYASVVFADLPGYLSDSLERIQKR 288 >SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 33.1 bits (72), Expect = 0.055 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 1/87 (1%) Frame = +1 Query: 55 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHI-DTLQSLQSRFCRLAVGAPLVRE 231 KRS + V+ ++TC+RP+ YA V+ + +++ ++L+ +Q R R+ P Sbjct: 670 KRSGLGKSVLVSFFRTCVRPITEYACPVYHDSLPSYLSNSLEQVQRRGLRIIY--PYCPY 727 Query: 232 ER*PTRRPSLESIQKYMKSTSERYFDK 312 E L S+ +S ++ FDK Sbjct: 728 EE-ALAEAELVSLADRRQSLTDTLFDK 753 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 33.1 bits (72), Expect = 0.055 Identities = 17/60 (28%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAV 210 RLY + K+ + +++ VT+Y + IR + YASV+F + + L+ +Q R ++ + Sbjct: 2747 RLYALRTLKKCGVPVKDMVTVYCSLIRSITEYASVIFPNIPCYLSEALEKIQRRALKIII 2806 >SB_30875| Best HMM Match : Rubredoxin (HMM E-Value=1.6) Length = 1130 Score = 32.7 bits (71), Expect = 0.072 Identities = 18/68 (26%), Positives = 37/68 (54%), Gaps = 2/68 (2%) Frame = +1 Query: 34 RLYPMIC-KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHI-DTLQSLQSRFCRLA 207 RLY ++ KR+ + + + + Y TC+RP++ Y + + HA ++ + L+ +Q +A Sbjct: 271 RLYFLVLLKRTIVPVSDIIGFYDTCVRPILEYCAPLSYHAIPAYLKEDLEHIQKSALSIA 330 Query: 208 VGAPLVRE 231 A R+ Sbjct: 331 SPAMPYRD 338 >SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 890 Score = 32.7 bits (71), Expect = 0.072 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 RLY + K+ + + + VT+Y + IR V YASV+F++ + L+ +Q R ++ Sbjct: 773 RLYALRTLKKCGVPVEDMVTVYCSLIRSVTEYASVIFSNIPCYLSEVLEKIQRRALKI 830 >SB_1670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.7 bits (71), Expect = 0.072 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSL 183 RLY + + K+ + +T+Y++ IR V+ YAS FA+ + D L+++ Sbjct: 81 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLSNYLSDALENV 131 >SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) Length = 773 Score = 32.7 bits (71), Expect = 0.072 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 55 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDT-LQSLQSRFCRL 204 KR+ + + + Y TCIRP YA +F ++ ++ L+S Q R R+ Sbjct: 676 KRAHVKPKELILFYLTCIRPCTEYACALFHNSLTKYLAADLESCQKRVLRI 726 >SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1287 Score = 32.3 bits (70), Expect = 0.096 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 55 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDT-LQSLQSRFCRL 204 KR+ + + + Y TCIRP YA +F ++ ++ L+S Q R R+ Sbjct: 669 KRAHVKPKELILFYLTCIRPCTEYACALFHNSLTKYLAADLESCQKRALRI 719 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 32.3 bits (70), Expect = 0.096 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +1 Query: 94 YKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFCR 201 YKT +RP + YAS V++ ID ++++Q +RFC+ Sbjct: 516 YKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 554 >SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) Length = 244 Score = 32.3 bits (70), Expect = 0.096 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +1 Query: 94 YKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFCR 201 YKT +RP + YAS V++ ID ++++Q +RFC+ Sbjct: 98 YKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 136 >SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 689 Score = 32.3 bits (70), Expect = 0.096 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +1 Query: 94 YKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFCR 201 YKT +RP + YAS V++ ID ++++Q +RFC+ Sbjct: 584 YKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 622 >SB_9954| Best HMM Match : SLH (HMM E-Value=1.1) Length = 132 Score = 32.3 bits (70), Expect = 0.096 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +1 Query: 85 VTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 192 + +Y++ +R + YASVVFA R D+L+ +Q R Sbjct: 6 LVVYRSLVRSTLEYASVVFADLPRYLSDSLERVQKR 41 >SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1462 Score = 31.9 bits (69), Expect = 0.13 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 2/52 (3%) Frame = +1 Query: 88 TLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR--LAVGAPLVREER 237 +LY + +RP + YAS V+A A T + ++++LQ R + L A L +ER Sbjct: 858 SLYLSIVRPTVGYASEVWAPQAITDMRSVEALQRRATKVILTNSAELTYQER 909 >SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 943 Score = 31.9 bits (69), Expect = 0.13 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 2/52 (3%) Frame = +1 Query: 88 TLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR--LAVGAPLVREER 237 +LY + +RP + YAS V+A A T + ++++LQ R + L A L +ER Sbjct: 449 SLYLSIVRPTVGYASEVWAPQAITDMRSVEALQRRATKVILTNSAELTYQER 500 >SB_6318| Best HMM Match : RVT_1 (HMM E-Value=0.72) Length = 485 Score = 31.9 bits (69), Expect = 0.13 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSL 183 RLY + + K+ + +T+Y++ IR V+ YAS FA+ D L+++ Sbjct: 435 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENV 485 >SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) Length = 488 Score = 31.9 bits (69), Expect = 0.13 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 2/52 (3%) Frame = +1 Query: 88 TLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR--LAVGAPLVREER 237 +LY + +RP + YAS V+A A T + ++++LQ R + L A L +ER Sbjct: 392 SLYLSIVRPTVGYASEVWAPQAITDMRSVEALQRRATKVILTNSAELTYQER 443 >SB_18416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 31.5 bits (68), Expect = 0.17 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +1 Query: 79 NKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +++T Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 118 HRITDYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 162 >SB_10126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 31.5 bits (68), Expect = 0.17 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 55 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHI-DTLQSLQSRFCRL 204 KR+ + Y TCIRP+M YA VF ++ ++ L+ ++ R R+ Sbjct: 331 KRASLGSEELHQFYLTCIRPIMEYACPVFHNSLPDYLSQDLEIIRRRALRI 381 >SB_40765| Best HMM Match : DX (HMM E-Value=1.4) Length = 278 Score = 31.1 bits (67), Expect = 0.22 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 76 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 198 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 118 RVKVTAYTAIVRPMLEYASAAWDPHLKKDIASLEKVQRKAARFC 161 >SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21) Length = 692 Score = 31.1 bits (67), Expect = 0.22 Identities = 16/58 (27%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 RLY + K+ +S + + +Y + +RPV+ YAS V++ ++ ++S+Q + R+ Sbjct: 550 RLYAIRALKKCGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQIKVLRI 607 >SB_59555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 898 Score = 30.7 bits (66), Expect = 0.29 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 34 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 192 RLY + KRS ++ + +Y IRP+M YA VFA + L+ +Q R Sbjct: 687 RLYALRKLKRSGVADSEIIQVYCCLIRPIMEYACAVFADLPQYLSHALERVQKR 740 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 30.7 bits (66), Expect = 0.29 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 76 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 198 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 909 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 952 >SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 174 Score = 30.7 bits (66), Expect = 0.29 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 76 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 198 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 14 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 57 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 30.7 bits (66), Expect = 0.29 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 76 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 198 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 215 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 258 >SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) Length = 634 Score = 30.7 bits (66), Expect = 0.29 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +1 Query: 37 LYPMICKRSKMSLRNKVTLYKTCIRPVMTYAS 132 L P++C +S +SL + +Y +C+R + YAS Sbjct: 474 LLPILCSKS-LSLHTRGRIYSSCVRGALLYAS 504 >SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 361 Score = 30.7 bits (66), Expect = 0.29 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 76 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 198 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 201 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 244 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 30.7 bits (66), Expect = 0.29 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 76 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 198 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 447 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 490 >SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 864 Score = 30.7 bits (66), Expect = 0.29 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 76 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 198 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 631 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 674 >SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) Length = 863 Score = 30.7 bits (66), Expect = 0.29 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 76 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 198 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 733 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 776 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 30.7 bits (66), Expect = 0.29 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 76 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 198 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 421 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 464 >SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 30.7 bits (66), Expect = 0.29 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 76 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 198 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 664 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 707 >SB_35861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 30.7 bits (66), Expect = 0.29 Identities = 19/59 (32%), Positives = 27/59 (45%) Frame = +1 Query: 37 LYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 L + K+ +S K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 158 LNEQLTKQIVLSQSVKERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 216 >SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 719 Score = 30.7 bits (66), Expect = 0.29 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 76 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 198 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 623 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 666 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 30.7 bits (66), Expect = 0.29 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 76 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 198 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 506 RVKVTAYTAIVRPMLEYASAAWDPYLQKDIASLEKVQRKAARFC 549 >SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 546 Score = 30.7 bits (66), Expect = 0.29 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 76 RNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQ---SRFC 198 R KVT Y +RP++ YAS + + I +L+ +Q +RFC Sbjct: 439 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 482 >SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 638 Score = 30.3 bits (65), Expect = 0.39 Identities = 13/40 (32%), Positives = 25/40 (62%) Frame = +1 Query: 85 VTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 V +Y + IR ++ YA+VVF++ + + L+ +Q R R+ Sbjct: 132 VAVYCSLIRSILEYATVVFSNLPKYLSEALEKVQKRSLRI 171 >SB_6579| Best HMM Match : RVT_1 (HMM E-Value=2.5e-14) Length = 952 Score = 29.9 bits (64), Expect = 0.51 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 34 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 192 RLY + KRS ++ + +Y IRP+M YA VFA + L+ +Q R Sbjct: 808 RLYALRKLKRSGVADSEIMQVYCRLIRPIMEYACTVFADLPQYLSHALERVQKR 861 >SB_45899| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) Length = 707 Score = 29.9 bits (64), Expect = 0.51 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +1 Query: 85 VTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 192 V +Y + IR ++ YASVVF++ + + L+ +Q R Sbjct: 639 VAVYCSLIRSILEYASVVFSNLPKYLSEALEKVQKR 674 >SB_34939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 29.9 bits (64), Expect = 0.51 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 RLY + + K+S ++ + VT+Y + IR + YAS +A + L+S+Q + R Sbjct: 164 RLYGLRVLKKSGLASEDLVTVYCSIIRSTLEYASPAWAALPGYLSELLESVQRKALR 220 >SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) Length = 593 Score = 29.5 bits (63), Expect = 0.68 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 25 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 201 I GR+ + + + L+ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 404 IAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 463 Query: 202 LAVGA 216 L + A Sbjct: 464 LILNA 468 >SB_24320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 29.5 bits (63), Expect = 0.68 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 25 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 201 I GR+ + + + L+ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 77 IAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 136 Query: 202 LAVGA 216 L + A Sbjct: 137 LILNA 141 >SB_12986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 29.5 bits (63), Expect = 0.68 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 25 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 201 I GR+ + + + L+ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 79 IAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 138 Query: 202 LAVGA 216 L + A Sbjct: 139 LILNA 143 >SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 29.5 bits (63), Expect = 0.68 Identities = 15/62 (24%), Positives = 29/62 (46%) Frame = +1 Query: 28 LGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLA 207 + +L + + K+++ K+T+Y+ CI + Y S + AR L + R R Sbjct: 81 MSKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRI 139 Query: 208 VG 213 +G Sbjct: 140 LG 141 >SB_7040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 29.5 bits (63), Expect = 0.68 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 25 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 201 I GR+ + + + ++ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 139 IAGRIGVLNKIKGCLPIKQRTNFYNAMIKPLFSYAGTVWQTASTKDSLSKFLTLQKRAAR 198 Query: 202 LAVGA 216 L + A Sbjct: 199 LILNA 203 >SB_51996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 29.5 bits (63), Expect = 0.68 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 25 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 201 I GR+ + + + L+ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 187 IAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 246 Query: 202 LAVGA 216 L + A Sbjct: 247 LILNA 251 >SB_51096| Best HMM Match : Baculo_ME53 (HMM E-Value=5.6) Length = 238 Score = 29.5 bits (63), Expect = 0.68 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 25 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 201 I GR+ + + + L+ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 139 IAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 198 Query: 202 LAVGA 216 L + A Sbjct: 199 LILNA 203 >SB_41403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1415 Score = 29.5 bits (63), Expect = 0.68 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 25 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 201 I GR+ + + + L+ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 198 IAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 257 Query: 202 LAVGA 216 L + A Sbjct: 258 LILNA 262 >SB_28070| Best HMM Match : RRM_1 (HMM E-Value=1.3e-07) Length = 694 Score = 29.5 bits (63), Expect = 0.68 Identities = 19/43 (44%), Positives = 22/43 (51%) Frame = +2 Query: 128 RVWYSLTRPAHT*TPSNPYNPAFAG*PSGLRWFVRNVDLHDDR 256 RV YS+T+ AHT TP A SG R R D +DDR Sbjct: 233 RVDYSVTKRAHTPTPGVYMGKASQHRDSGRRGGGRRYDDYDDR 275 >SB_6674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 303 Score = 29.5 bits (63), Expect = 0.68 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 25 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 201 I GR+ + + + L+ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 114 IAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 173 Query: 202 LAVGA 216 L + A Sbjct: 174 LILNA 178 >SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) Length = 890 Score = 29.5 bits (63), Expect = 0.68 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 25 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 201 I GR+ + + + L+ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 701 IAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 760 Query: 202 LAVGA 216 L + A Sbjct: 761 LILNA 765 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 29.1 bits (62), Expect = 0.89 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 755 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 798 >SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) Length = 314 Score = 29.1 bits (62), Expect = 0.89 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 259 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 302 >SB_43127| Best HMM Match : DUF1690 (HMM E-Value=2.2) Length = 449 Score = 29.1 bits (62), Expect = 0.89 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 159 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 202 >SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) Length = 858 Score = 29.1 bits (62), Expect = 0.89 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 91 LYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 219 LY T +RP + YAS +++ + H ++++Q R + + P Sbjct: 728 LYCTLVRPHLEYASCIWSPSTGKHKALIENIQCRASKFILNYP 770 >SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 198 Score = 29.1 bits (62), Expect = 0.89 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 35 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 78 >SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) Length = 284 Score = 29.1 bits (62), Expect = 0.89 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 121 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 164 >SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) Length = 661 Score = 29.1 bits (62), Expect = 0.89 Identities = 16/65 (24%), Positives = 30/65 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 464 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 522 Query: 214 APLVR 228 +R Sbjct: 523 IHWLR 527 >SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) Length = 243 Score = 29.1 bits (62), Expect = 0.89 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 80 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 123 >SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 792 Score = 29.1 bits (62), Expect = 0.89 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 91 LYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 219 LY T +RP + YAS +++ + H ++++Q R + + P Sbjct: 631 LYCTLVRPSLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 673 >SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2529 Score = 29.1 bits (62), Expect = 0.89 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 1462 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 1505 >SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) Length = 243 Score = 29.1 bits (62), Expect = 0.89 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 80 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 123 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 29.1 bits (62), Expect = 0.89 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 446 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 489 >SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) Length = 409 Score = 29.1 bits (62), Expect = 0.89 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 259 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 302 >SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 29.1 bits (62), Expect = 0.89 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 91 LYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 219 LY T +RP + YAS +++ + H ++++Q R + + P Sbjct: 134 LYCTLVRPSLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 176 >SB_18362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 29.1 bits (62), Expect = 0.89 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 25 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 201 I GR+ + + + L+ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 74 IAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLTRFLTLQKRAAR 133 Query: 202 LAVGA 216 L + A Sbjct: 134 LILNA 138 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 29.1 bits (62), Expect = 0.89 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 674 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 717 >SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 29.1 bits (62), Expect = 0.89 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 91 LYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 219 LY T +RP + YAS +++ + H ++++Q R + + P Sbjct: 134 LYCTLVRPHLEYASCIWSPSTGKHKALIENVQRRASKFVLNYP 176 >SB_16338| Best HMM Match : PHD (HMM E-Value=3.8e-08) Length = 652 Score = 29.1 bits (62), Expect = 0.89 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 37 LYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFA 144 L P++ +S +SLR + +Y +C+R M YA +A Sbjct: 549 LLPVLSSKS-LSLRTRGKVYSSCVRSAMLYAGECWA 583 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 29.1 bits (62), Expect = 0.89 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 436 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 479 >SB_8726| Best HMM Match : Pox_F16 (HMM E-Value=5.2) Length = 244 Score = 29.1 bits (62), Expect = 0.89 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 K Y + IRPVM YAS V+ I+ L+ +Q R G Sbjct: 141 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 184 >SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 370 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 167 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 225 >SB_56417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 28.7 bits (61), Expect = 1.2 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 91 LYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 219 LY T +RP + YAS +++ + H ++++Q R + + P Sbjct: 86 LYCTLVRPHLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 128 >SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 226 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 >SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 553 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 611 >SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 223 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 >SB_35414| Best HMM Match : NinE (HMM E-Value=8.4) Length = 172 Score = 28.7 bits (61), Expect = 1.2 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +1 Query: 58 RSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 RS + L ++ + I+PVM YA+V+++ + + Q R R Sbjct: 35 RSYLPLNQRINHFNAIIKPVMNYANVIWSTCDKESQYRILKFQKRAAR 82 >SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) Length = 590 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 515 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 573 >SB_24260| Best HMM Match : Rotavirus_VP7 (HMM E-Value=7.7) Length = 319 Score = 28.7 bits (61), Expect = 1.2 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 25 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 201 I GR+ + + + ++ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 180 IAGRIGVLNKIKGCLPIKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 239 Query: 202 LAVGA 216 L + A Sbjct: 240 LILNA 244 >SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 84 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 142 >SB_7633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 28.7 bits (61), Expect = 1.2 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 25 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 201 I GR+ + + + ++ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 198 IAGRIGVLNKIKGCLPIKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 257 Query: 202 LAVGA 216 L + A Sbjct: 258 LILNA 262 >SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 84 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLHTFHMRCLRRILG 142 >SB_58494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 84 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLHTFHMRCLRRILG 142 >SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) Length = 754 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 >SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) Length = 458 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 304 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 362 >SB_53437| Best HMM Match : DUF1126 (HMM E-Value=5.1) Length = 92 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 >SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 226 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 2395 KLSSRVWENKKLTISTKITVYRACILSTLLYGSEPWTTYARQE-KRLNTFHMRCLRRILG 2453 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 84 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLHTFHMRCLRRILG 142 >SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) Length = 1354 Score = 28.7 bits (61), Expect = 1.2 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 91 LYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 219 LY T +RP + YAS +++ + H ++++Q R + + P Sbjct: 879 LYCTLVRPHLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 921 >SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 290 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 136 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 194 >SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 280 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 84 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 142 >SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1868 Score = 28.7 bits (61), Expect = 1.2 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 91 LYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 219 LY T +RP + YAS +++ + H ++++Q R + + P Sbjct: 1772 LYCTLVRPHLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 1814 >SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 406 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 >SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) Length = 322 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 233 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 291 >SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 119 KLSSRVWENKKLTISTKITVYRACILSTLLYGSKSWTTYARQE-KRLNTFHMRCLRRILG 177 >SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 416 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 193 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 251 >SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 348 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 136 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 194 >SB_17216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 28.7 bits (61), Expect = 1.2 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 25 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTHIDTLQSLQSRFCR 201 I GR+ + + + ++ + Y I+P+ +YA V+ A+ + + +LQ R R Sbjct: 79 IAGRIGVLNKIKGCLPIKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAAR 138 Query: 202 LAVGA 216 L + A Sbjct: 139 LILNA 143 >SB_8964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 84 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLHTFHMRCLRRILG 142 >SB_4883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 28.7 bits (61), Expect = 1.2 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 91 LYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 219 LY T +RP + YAS +++ + H ++++Q R + + P Sbjct: 555 LYCTLVRPHLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 597 >SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 >SB_54561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 28.3 bits (60), Expect = 1.6 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 91 LYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAP 219 LY T +RP + YAS +++ + H ++++Q R + + P Sbjct: 139 LYCTFVRPHLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 181 >SB_47925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 28.3 bits (60), Expect = 1.6 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 7/63 (11%) Frame = +1 Query: 16 TAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYA----SVVFAHAA---RTHIDTL 174 TAF GRL + R +S++ K+ +YK + P++ Y+ +V +HA R H++ L Sbjct: 76 TAF--GRLRKKVWGRRGLSMKTKLKVYKAIVLPLLLYSCETWTVYSSHAKKLDRFHMNCL 133 Query: 175 QSL 183 + + Sbjct: 134 RKI 136 >SB_42199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 28.3 bits (60), Expect = 1.6 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 7/63 (11%) Frame = +1 Query: 16 TAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYA----SVVFAHAA---RTHIDTL 174 TAF GRL + R +S++ K+ +YK + P++ Y+ +V +HA R H++ L Sbjct: 76 TAF--GRLRKKVWGRRGLSMKTKLKVYKAIVLPLLLYSCETWTVYSSHAKKLDRFHMNCL 133 Query: 175 QSL 183 + + Sbjct: 134 RKI 136 >SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) Length = 677 Score = 28.3 bits (60), Expect = 1.6 Identities = 14/60 (23%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ C+ + Y S + AR L + R R +G Sbjct: 475 KLSSRVWENKKLTISTKITVYRACVLSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 533 >SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) Length = 530 Score = 28.3 bits (60), Expect = 1.6 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAAR 156 +L + + K+++ K+T+Y+ CI + Y S + AR Sbjct: 307 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYAR 347 >SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 28.3 bits (60), Expect = 1.6 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAAR 156 +L + + K+++ K+T+Y+ CI + Y S + AR Sbjct: 187 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYAR 227 >SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1) Length = 173 Score = 28.3 bits (60), Expect = 1.6 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 +L + + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 84 KLSSRVWENKKLTISTKITVYRACILNTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 142 >SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 28.3 bits (60), Expect = 1.6 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAAR 156 +L + + K+++ K+T+Y+ CI + Y S + AR Sbjct: 597 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYAR 637 >SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4527 Score = 27.9 bits (59), Expect = 2.1 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 RLY + + K+S ++ + T+Y + +R + YAS +A + L+S+Q + R Sbjct: 4375 RLYGLRVLKKSGLTSEDLATVYCSIVRSTLEYASPAWAALPGYLSELLESVQRKAMR 4431 >SB_42059| Best HMM Match : RVT_1 (HMM E-Value=0.0011) Length = 272 Score = 27.9 bits (59), Expect = 2.1 Identities = 14/38 (36%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFA 144 RLY + K+S +S + + +Y + +RPV+ YAS V++ Sbjct: 229 RLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVWS 266 >SB_56913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1603 Score = 27.9 bits (59), Expect = 2.1 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 40 YPMICKRSKMSLRNKVTLYKTCIRPVMTYASVV 138 + + K + S R +VTL+ +RPV+ +A +V Sbjct: 579 FAQLLKARRQSHRERVTLHSLMLRPVIRFAQLV 611 >SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) Length = 407 Score = 27.9 bits (59), Expect = 2.1 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +1 Query: 109 RPVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 +P++ Y ++V+ + HID + Q R R+ Sbjct: 291 KPILDYGAIVWGSTKKQHIDDMVKFQKRCARV 322 >SB_31184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 724 Score = 27.5 bits (58), Expect = 2.7 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +1 Query: 34 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHA 150 +LY +I KR+++ + YK CIR + YA VF +A Sbjct: 582 KLYFLIQLKRARLPPSDLSLFYKACIRSAVDYAVPVFHNA 621 >SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 27.5 bits (58), Expect = 2.7 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = +1 Query: 55 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVG 213 + K+++ K+T+Y+ CI + Y S + AR L + R R +G Sbjct: 126 ENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 177 >SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 27.5 bits (58), Expect = 2.7 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAV 210 K YK +RP++ Y + ++ + I ++S+Q C++ V Sbjct: 250 KEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRPRCQICV 292 >SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 27.5 bits (58), Expect = 2.7 Identities = 10/37 (27%), Positives = 23/37 (62%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 192 K + Y+T +RP + YA++ + + +I+ ++ +Q R Sbjct: 175 KDSAYRTLVRPKLEYATIAWNPYTQCNINKIEMIQRR 211 >SB_32094| Best HMM Match : RVT_1 (HMM E-Value=1.9e-12) Length = 642 Score = 27.5 bits (58), Expect = 2.7 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +1 Query: 34 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHA 150 +LY +I KR+++ + YK CIR + YA VF +A Sbjct: 500 KLYFLIQLKRARLPPSDLSLFYKACIRSAVDYAVPVFHNA 539 >SB_15386| Best HMM Match : CSE2 (HMM E-Value=0.18) Length = 379 Score = 27.5 bits (58), Expect = 2.7 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +1 Query: 34 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHA 150 +LY +I KR+++ + YK CIR + YA VF +A Sbjct: 237 KLYFLIQLKRARLPPSDLSLFYKACIRSAVDYAVPVFHNA 276 >SB_55856| Best HMM Match : TPR_2 (HMM E-Value=4.1e-14) Length = 742 Score = 27.1 bits (57), Expect = 3.6 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 34 RLYPM-ICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 192 RLY + + RS + + + +Y IRP++ YAS V A D ++ +Q + Sbjct: 600 RLYGLRVLWRSGLPPLDLINVYCAVIRPILEYASPVSAALPEYLADLIEMVQRK 653 >SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) Length = 434 Score = 27.1 bits (57), Expect = 3.6 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +1 Query: 58 RSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 R+ + K+ LYK+ + P +TY + + + L+ LQ R R Sbjct: 341 RNLIPTNAKLVLYKSAVLPYLTYCHLTWHFCKASDSRKLERLQERALR 388 >SB_45989| Best HMM Match : TFIIE_alpha (HMM E-Value=5) Length = 194 Score = 27.1 bits (57), Expect = 3.6 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +1 Query: 34 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHA 150 +LY +I KR+++ + YK CIR + YA VF +A Sbjct: 51 KLYFLIELKRARLPPSDLSLFYKPCIRSAVDYAVPVFHNA 90 >SB_45959| Best HMM Match : DUF1091 (HMM E-Value=3.6) Length = 360 Score = 27.1 bits (57), Expect = 3.6 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +1 Query: 34 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHA 150 +LY +I KR+++ + YK CIR + YA VF +A Sbjct: 164 KLYFLIQLKRARLPPTDLSLFYKACIRSAVGYAVPVFHNA 203 >SB_36728| Best HMM Match : ArsD (HMM E-Value=1.6) Length = 364 Score = 27.1 bits (57), Expect = 3.6 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 192 R+ ++C R + + K+ +YK I P ++Y + + ++ + L+ + R Sbjct: 304 RIGVLMCLRKLIPVTAKLRIYKAAILPHLSYCGLTWHFCRKSDSNKLERVNER 356 >SB_32837| Best HMM Match : RVT_1 (HMM E-Value=8.3e-17) Length = 327 Score = 27.1 bits (57), Expect = 3.6 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K Y + +RPV YAS ++ + I+ ++S+Q R R Sbjct: 259 KEKAYISLVRPVAEYASPAWSPHTQKDINCVESIQRRAAR 298 >SB_31881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.1 bits (57), Expect = 3.6 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +1 Query: 112 PVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 P++ Y ++V+ + HID + Q R R+ Sbjct: 1 PILDYGAIVWGSTKKQHIDDMVKFQKRCARV 31 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 27.1 bits (57), Expect = 3.6 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K YKT +RP + YA+ V+ + L R+C+ Sbjct: 1177 KERAYKTLVRPKLEYAAAVWNPYTTKDVSLLXXXXRRWCK 1216 Score = 26.2 bits (55), Expect = 6.3 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K YKT +RP + YA+ V+ + L+ +Q R Sbjct: 1369 KERAYKTLVRPKLEYAAAVWNPYTTKDVSLLEQVQKSAAR 1408 >SB_27763| Best HMM Match : VapD_N (HMM E-Value=10) Length = 243 Score = 27.1 bits (57), Expect = 3.6 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K Y + +RPV YAS ++ + I+ ++S+Q R R Sbjct: 175 KEKAYISLVRPVAEYASPAWSPHTQKDINCVESIQRRAAR 214 >SB_47944| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.1 bits (57), Expect = 3.6 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -2 Query: 310 YRSTVPTLTSC-ISGLIQGSVVV*VNVP 230 Y+STVP T+C I GL+ + VN+P Sbjct: 78 YKSTVPRFTNCAIEGLMYVERTINVNLP 105 >SB_39804| Best HMM Match : VapD_N (HMM E-Value=10) Length = 194 Score = 27.1 bits (57), Expect = 3.6 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K Y + +RPV YAS ++ + I+ ++S+Q R R Sbjct: 126 KEKAYISLVRPVAEYASPAWSPHTQKDINCVESIQRRAAR 165 >SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 402 Score = 27.1 bits (57), Expect = 3.6 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFC 198 K Y T +RP++ YA+ + T ++ L+ +Q C Sbjct: 357 KERAYFTLVRPILEYAAPAWNPYTDTDVNRLEQVQKNAC 395 >SB_58879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1786 Score = 26.6 bits (56), Expect = 4.8 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = +1 Query: 34 RLYPMICKRSKMSLRNK--VTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 192 RLY IC+ K + + Y IR YASVVFA + ++L++++ R Sbjct: 589 RLYA-ICQLKKCGVPTSEIIKAYCALIRSSTEYASVVFAGLPKYLCNSLENIKKR 642 >SB_49069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 26.6 bits (56), Expect = 4.8 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +1 Query: 112 PVMTYASVVFAHAARTHIDTLQSLQSRFCRL 204 P++ Y +V+ + HID + Q R R+ Sbjct: 1 PILDYGDIVWGSTKKQHIDDMVKFQKRCARV 31 >SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) Length = 325 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K + Y+T +RP + YA+ + + +I+ ++ +Q R R Sbjct: 259 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 298 >SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K + Y+T +RP + YA+ + + +I+ ++ +Q R R Sbjct: 259 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 298 >SB_39569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 79 NKVTLYKTCIRPVMTYASVVFAHA 150 N+ YK CIR + YA VF +A Sbjct: 646 NRTLFYKACIRSAVDYAVPVFHNA 669 >SB_38350| Best HMM Match : OCIA (HMM E-Value=6.7) Length = 537 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K + Y+T +RP + YA+ + + +I+ ++ +Q R R Sbjct: 223 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 262 >SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) Length = 311 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K + Y+T +RP + YA+ + + +I+ ++ +Q R R Sbjct: 175 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 214 >SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) Length = 388 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K + Y+T +RP + YA+ + + +I+ ++ +Q R R Sbjct: 259 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 298 >SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1360 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K + Y+T +RP + YA+ + + +I+ ++ +Q R R Sbjct: 815 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 854 >SB_21287| Best HMM Match : Lectin_C (HMM E-Value=3.1) Length = 179 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K + Y+T +RP + YA+ + + +I+ ++ +Q R R Sbjct: 113 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 152 >SB_16738| Best HMM Match : DUF217 (HMM E-Value=7.8) Length = 261 Score = 26.6 bits (56), Expect = 4.8 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +1 Query: 109 RPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 +P++ Y ++V+ + HID + Q R R Sbjct: 231 KPILDYGAIVWGSTKKHHIDDMIKFQKRCAR 261 >SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) Length = 769 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K + Y+T +RP + YA+ + + +I+ ++ +Q R R Sbjct: 703 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 742 >SB_8874| Best HMM Match : PhaG_MnhG_YufB (HMM E-Value=2.4) Length = 252 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K + Y+T +RP + YA+ + + +I+ ++ +Q R R Sbjct: 208 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 247 >SB_5302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 26.6 bits (56), Expect = 4.8 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +1 Query: 37 LYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFA 144 L P++ +S +SLR + +Y +C+R YA +A Sbjct: 888 LLPVLSSKS-LSLRTRGKVYSSCVRSATLYAGECWA 922 >SB_270| Best HMM Match : PHD (HMM E-Value=0.0037) Length = 251 Score = 26.6 bits (56), Expect = 4.8 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +1 Query: 37 LYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFA 144 L P++ +S +SLR + +Y +C+R YA +A Sbjct: 190 LLPVLSSKS-LSLRTRGKVYSSCVRSATLYAGECWA 224 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K + Y+T +RP + YA+ + + +I+ ++ +Q R R Sbjct: 883 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 922 >SB_44566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 26.6 bits (56), Expect = 4.8 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 25 ILGRLYPMICKRSKMSLRNKVTLYKTCIRP 114 ++G + P +CK S +N L K CIRP Sbjct: 192 VMGLVDPRMCKVSSKWSQNIRVLIKDCIRP 221 >SB_35350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 626 Score = 26.6 bits (56), Expect = 4.8 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 55 KRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHI 165 K S + L+N KTCI P M+ + + H R H+ Sbjct: 505 KFSPVILKNPTVFKKTCILP-MSLSKIEVNHLVRLHV 540 >SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 801 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K + Y+T +RP + YA+ + + +I+ ++ +Q R R Sbjct: 673 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 712 >SB_19421| Best HMM Match : Ribosomal_L36 (HMM E-Value=0.85) Length = 647 Score = 26.6 bits (56), Expect = 4.8 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -3 Query: 156 AGRVSEYHTRVSHDGPYASFVKCHLVPKGHFTPLTDHGIESAE 28 A ++S T +S P A K +VP GH T L IE +E Sbjct: 188 AKKLSSDTTSISALKPDAGITKTGIVPPGHDTVLNGSEIELSE 230 >SB_58751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K YK +RP++ Y + ++ + I ++S+Q R R Sbjct: 149 KEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 188 >SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 533 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K YK +RP++ Y + ++ + I ++S+Q R R Sbjct: 432 KEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 471 >SB_53749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K YK +RP++ Y + ++ + I ++S+Q R R Sbjct: 70 KEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 109 >SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1025 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K YK +RP++ Y + ++ + I ++S+Q R R Sbjct: 944 KEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 983 >SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 880 Score = 26.2 bits (55), Expect = 6.3 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +1 Query: 58 RSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 R+ + + K+ LYK+ I P +TY V+ L+ +Q R R Sbjct: 756 RNLIPVDAKLQLYKSAILPNLTYCHTVWHFCKAADARKLERVQERALR 803 >SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) Length = 490 Score = 26.2 bits (55), Expect = 6.3 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +1 Query: 58 RSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 R+ + + K+ LYK+ I P +TY V+ L+ +Q R R Sbjct: 385 RNLIPVDAKLQLYKSAILPNLTYCHTVWHFCKAADARKLERVQERALR 432 >SB_33786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K YK +RP++ Y + ++ + I ++S+Q R R Sbjct: 4 KEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 43 >SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 2075 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 235 VPHEPAEPRRLTCK 194 VP EPAEPR LT K Sbjct: 461 VPEEPAEPRELTPK 474 >SB_18309| Best HMM Match : Exo_endo_phos (HMM E-Value=2.3e-09) Length = 895 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K YK +RP++ Y + ++ + I ++S+Q R R Sbjct: 762 KEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 801 >SB_17007| Best HMM Match : VWA (HMM E-Value=4.6e-06) Length = 453 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K YK +RP++ Y + ++ + I ++S+Q R R Sbjct: 342 KEQAYKALVRPLVEYGTKAWSPHTKKDIQKVESVQRRAAR 381 >SB_12291| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-09) Length = 843 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K YK +RP++ Y + ++ + I ++S+Q R R Sbjct: 671 KEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 710 >SB_10379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K YK +RP++ Y + ++ + I ++S+Q R R Sbjct: 164 KEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 203 >SB_2841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3297 Score = 26.2 bits (55), Expect = 6.3 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -2 Query: 109 LCK-FCKVSPCSEGTFYSAYRSWDRVC 32 LCK F +P S G Y YR++D VC Sbjct: 315 LCKVFDLFTPFSIGLVYLMYRAFDEVC 341 >SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) Length = 558 Score = 26.2 bits (55), Expect = 6.3 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +1 Query: 58 RSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 R+ + + K+ LYK+ I P +TY V+ L+ +Q R R Sbjct: 385 RNLIPVDAKLQLYKSAILPNLTYCHTVWHFCKAADARKLERVQERALR 432 >SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) Length = 823 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K YK +RP++ Y + ++ + I ++S+Q R R Sbjct: 424 KEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 463 >SB_15410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1147 Score = 26.2 bits (55), Expect = 6.3 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 97 CKVSPCSEGTFYSAYRSWDRVCRE*M 20 C +PC++GT Y+ S+ VC + M Sbjct: 178 CDHNPCADGTCYNTMGSYKCVCPDGM 203 >SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1009 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K YK +RP++ Y + ++ + I ++S+Q R R Sbjct: 876 KEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 915 >SB_11192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 26.2 bits (55), Expect = 6.3 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +1 Query: 34 RLYPMI-CKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHA 150 +LY +I KR+++ + +YK CIR + +A VF +A Sbjct: 148 KLYFLIQLKRARLPPSDLSLIYKACIRSAVDHAVPVFHNA 187 >SB_11114| Best HMM Match : UPF0203 (HMM E-Value=9.6) Length = 197 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K YK +RP++ Y + ++ + I ++S+Q R R Sbjct: 96 KEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 135 >SB_8972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 26.2 bits (55), Expect = 6.3 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -2 Query: 310 YRSTVPTLTSC-ISGLIQGSVVV*VNVP 230 Y+STVP T+C + GL+ + VN+P Sbjct: 78 YKSTVPRFTNCALEGLMYVERTINVNLP 105 >SB_50918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1112 Score = 25.8 bits (54), Expect = 8.3 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K Y +RP++ YAS ++ R I ++ +Q R R Sbjct: 789 KEAAYVGLVRPLLEYASAIWDQHTRKLIVEIEKVQRRAAR 828 >SB_39420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 993 Score = 25.8 bits (54), Expect = 8.3 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 185 NPAFAG*PSGLRWFVRNVDLH-DDRALNQSRNT*SQRRNGT 304 N F+G PS LR +N+D H + N SRN + R GT Sbjct: 380 NVVFSGLPSYLRQKKKNMDSHSSSKNGNHSRNA-TDLRTGT 419 >SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 25.8 bits (54), Expect = 8.3 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K + Y+T +RP + YA+ + + +I ++ +Q R R Sbjct: 573 KDSAYRTLVRPKLEYATSAWNPYTQCNIKKIEMIQRRAAR 612 >SB_58983| Best HMM Match : Integrin_alpha (HMM E-Value=2.7) Length = 237 Score = 25.8 bits (54), Expect = 8.3 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSR 192 K YKT + P + YAS + + H+ ++ +Q R Sbjct: 115 KEAAYKTLVLPHLEYASSAWDPWLKKHVKQIEKVQRR 151 >SB_30161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 25.8 bits (54), Expect = 8.3 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K YK +RP++ Y + ++ + I ++S+Q R R Sbjct: 164 KEQAYKALVRPLVEYGTEAWSPHTQKDIQKVESVQRRAAR 203 >SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) Length = 267 Score = 25.8 bits (54), Expect = 8.3 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +1 Query: 82 KVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCR 201 K + Y+T +RP + YA+ + + +I ++ +Q R R Sbjct: 201 KDSAYRTLVRPKLEYATSAWNPYTQCNIKKIEMIQRRAAR 240 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,961,006 Number of Sequences: 59808 Number of extensions: 187820 Number of successful extensions: 816 Number of sequences better than 10.0: 245 Number of HSP's better than 10.0 without gapping: 746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 816 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 450550116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -