BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10636X (376 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 22 2.1 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 22 2.1 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 6.3 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 6.3 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 6.3 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 6.3 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 20 8.3 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 20 8.3 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 20 8.3 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 20 8.3 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 20 8.3 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 20 8.3 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 20 8.3 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 20 8.3 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 20 8.3 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 20 8.3 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 20 8.3 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 20 8.3 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 20 8.3 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 20 8.3 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 20 8.3 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 22.2 bits (45), Expect = 2.1 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +1 Query: 166 INLVCREYLFLYRYYINV-YNLYCIEMMHS 252 I L C EYLF ++ +V + + +EM+ S Sbjct: 394 IGLKCLEYLFFFKMIGDVPIDDFLVEMLES 423 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 22.2 bits (45), Expect = 2.1 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +1 Query: 166 INLVCREYLFLYRYYINV-YNLYCIEMMHS 252 I L C EYLF ++ +V + + +EM+ S Sbjct: 394 IGLKCLEYLFFFKMIGDVPIDDFLVEMLES 423 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 6.3 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 253 HYASSRYNINYIHLYNIDIKI 191 +Y YNINYI I + I Sbjct: 103 NYKKLYYNINYIEQIPIPVPI 123 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 6.3 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 253 HYASSRYNINYIHLYNIDIKI 191 +Y YNINYI I + I Sbjct: 103 NYKKLYYNINYIEQIPIPVPI 123 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 6.3 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 253 HYASSRYNINYIHLYNIDIKI 191 +Y YNINYI I + I Sbjct: 103 NYRKLYYNINYIEQIPIPVPI 123 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 6.3 Identities = 8/25 (32%), Positives = 11/25 (44%) Frame = -1 Query: 253 HYASSRYNINYIHLYNIDIKINTLY 179 +Y YNINYI + + Y Sbjct: 330 NYKPLHYNINYIEQIPVPVPFPVYY 354 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 8.3 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 259 QQHYASSRYNINYIHLYNIDIKI 191 + +Y YNINYI I + + Sbjct: 103 KHNYNKLYYNINYIEQIPIPVPV 125 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 20.2 bits (40), Expect = 8.3 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 253 HYASSRYNINYIHLYNIDIKI 191 +Y YNINYI I + + Sbjct: 105 NYKKLYYNINYIEQIPIPVPV 125 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 8.3 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 253 HYASSRYNINYIHLYNIDIKI 191 +Y YNINYI + I + Sbjct: 103 NYKKLYYNINYIEQVPVPIPV 123 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 8.3 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 259 QQHYASSRYNINYIHLYNIDIKI 191 + +Y YNINYI I + + Sbjct: 103 KHNYNKLYYNINYIEQIPIPVPV 125 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 8.3 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 259 QQHYASSRYNINYIHLYNIDIKI 191 + +Y YNINYI I + + Sbjct: 103 KHNYNKLYYNINYIEQIPIPVPV 125 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 8.3 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 259 QQHYASSRYNINYIHLYNIDIKI 191 + +Y YNINYI I + + Sbjct: 103 KHNYNKLYYNINYIEQIPIPVPV 125 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 8.3 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 259 QQHYASSRYNINYIHLYNIDIKI 191 + +Y YNINYI I + + Sbjct: 103 KHNYNKLYYNINYIEQIPIPVPV 125 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 8.3 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 259 QQHYASSRYNINYIHLYNIDIKI 191 + +Y YNINYI I + + Sbjct: 103 KHNYNKLYYNINYIEQIPIPVPV 125 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 8.3 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 259 QQHYASSRYNINYIHLYNIDIKI 191 + +Y YNINYI I + + Sbjct: 103 KHNYNKLYYNINYIEQIPIPVPV 125 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 8.3 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 259 QQHYASSRYNINYIHLYNIDIKI 191 + +Y YNINYI I + + Sbjct: 103 KHNYNKLYYNINYIEQIPIPVPV 125 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 8.3 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 259 QQHYASSRYNINYIHLYNIDIKI 191 + +Y YNINYI I + + Sbjct: 103 KHNYNKLYYNINYIEQIPIPVPV 125 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 20.2 bits (40), Expect = 8.3 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +1 Query: 235 IEMMHSVVVEATVCDQKKVTSGRPS 309 IE S+ T C VT RPS Sbjct: 248 IERAKSIRARRTECVTNSVTCDRPS 272 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 20.2 bits (40), Expect = 8.3 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 253 HYASSRYNINYIHLYNIDIKI 191 +Y YNINYI I + + Sbjct: 322 NYKKLYYNINYIEQIPIPVPV 342 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.2 bits (40), Expect = 8.3 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 259 QQHYASSRYNINYIHLYNIDIKI 191 + +Y YNINYI I + + Sbjct: 336 KHNYNKLYYNINYIEQIPIPVPV 358 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.2 bits (40), Expect = 8.3 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 259 QQHYASSRYNINYIHLYNIDIKI 191 + +Y YNINYI I + + Sbjct: 336 KHNYNKLYYNINYIEQIPIPVPV 358 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,004 Number of Sequences: 438 Number of extensions: 1568 Number of successful extensions: 42 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9052365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -