BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10636X (376 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g48530.1 68414.m05426 hypothetical protein 27 5.4 At5g03420.1 68418.m00295 dentin sialophosphoprotein-related cont... 26 9.4 >At1g48530.1 68414.m05426 hypothetical protein Length = 164 Score = 26.6 bits (56), Expect = 5.4 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +1 Query: 163 GINLVCREYLFLYRYYINVYNLYCIEMMHSVVVEATVCDQKK 288 G N EY F+Y+ + Y + C+ M ++V+A D K+ Sbjct: 66 GWNEFDEEYAFVYKCPVKRYLVKCLAMNDKLLVDAIAEDGKE 107 >At5g03420.1 68418.m00295 dentin sialophosphoprotein-related contains weak similarity to Swiss-Prot:Q9NZW4 dentin sialophosphoprotein precursor [Homo sapiens] Length = 583 Score = 25.8 bits (54), Expect = 9.4 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -1 Query: 289 LFFDHTLSPRQQHYASSRYNINYIHLYNIDIKINTLYTLS 170 L FDH SP HY S N + ++DI + Y L+ Sbjct: 257 LTFDHYTSPTSNHYTSPDLN----SIKHVDIATGSSYDLT 292 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,175,386 Number of Sequences: 28952 Number of extensions: 93496 Number of successful extensions: 124 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 507810264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -