BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10631 (398 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56340.1 68416.m06264 40S ribosomal protein S26 (RPS26C) seve... 139 5e-34 At2g40590.1 68415.m05007 40S ribosomal protein S26 (RPS26B) 137 2e-33 At2g40510.1 68415.m04999 40S ribosomal protein S26 (RPS26A) 137 2e-33 At1g52450.1 68414.m05921 ubiquitin carboxyl-terminal hydrolase-r... 27 4.6 >At3g56340.1 68416.m06264 40S ribosomal protein S26 (RPS26C) several 40S ribosomal protein S26 Length = 130 Score = 139 bits (337), Expect = 5e-34 Identities = 63/98 (64%), Positives = 74/98 (75%) Frame = +1 Query: 7 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 186 MT KRRNGGR KH RGHVK +RC+NC +C PKDKAIK+F++RNIVE AA+RD+ +ASVY Sbjct: 1 MTFKRRNGGRNKHNRGHVKPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE 60 Query: 187 MFQLPKLYAKLHYCVSCAIHSKVSGTDRRKTEESVLLP 300 + LPKLYAK YCVSCAIHS V R +T V P Sbjct: 61 GYTLPKLYAKTQYCVSCAIHSHVVRV-RSRTNRRVRTP 97 Score = 27.5 bits (58), Expect = 3.5 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 255 VRNRSKKDRRIRTPPKSNFPRDMSRPQAVQ 344 VR RS+ +RR+RTPP R P+ Q Sbjct: 84 VRVRSRTNRRVRTPPPRFARRKEDTPKPAQ 113 >At2g40590.1 68415.m05007 40S ribosomal protein S26 (RPS26B) Length = 131 Score = 137 bits (332), Expect = 2e-33 Identities = 62/98 (63%), Positives = 73/98 (74%) Frame = +1 Query: 7 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 186 MT KRRNGGR KH RGHV +RC+NC +C PKDKAIK+F++RNIVE AA+RD+ +ASVY Sbjct: 1 MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE 60 Query: 187 MFQLPKLYAKLHYCVSCAIHSKVSGTDRRKTEESVLLP 300 + LPKLYAK YCVSCAIHS V R +T V P Sbjct: 61 GYTLPKLYAKTQYCVSCAIHSHVVRV-RSRTNRRVRTP 97 Score = 26.2 bits (55), Expect = 8.0 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 255 VRNRSKKDRRIRTPPKSNFPRDMSRPQAVQ 344 VR RS+ +RR+RTPP R P+ Q Sbjct: 84 VRVRSRTNRRVRTPPPRFTRRKEDTPKPGQ 113 >At2g40510.1 68415.m04999 40S ribosomal protein S26 (RPS26A) Length = 133 Score = 137 bits (332), Expect = 2e-33 Identities = 62/98 (63%), Positives = 73/98 (74%) Frame = +1 Query: 7 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 186 MT KRRNGGR KH RGHV +RC+NC +C PKDKAIK+F++RNIVE AA+RD+ +ASVY Sbjct: 1 MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE 60 Query: 187 MFQLPKLYAKLHYCVSCAIHSKVSGTDRRKTEESVLLP 300 + LPKLYAK YCVSCAIHS V R +T V P Sbjct: 61 GYTLPKLYAKTQYCVSCAIHSHVVRV-RSRTNRRVRTP 97 Score = 26.2 bits (55), Expect = 8.0 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 255 VRNRSKKDRRIRTPPKSNFPRDMSRPQAVQ 344 VR RS+ +RR+RTPP R P+ Q Sbjct: 84 VRVRSRTNRRVRTPPPRFARRKEDTPKPGQ 113 >At1g52450.1 68414.m05921 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1136 Score = 27.1 bits (57), Expect = 4.6 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +1 Query: 64 AVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYPMFQLPKL 207 ++ C C VP+ +K + AVRD+ + ++ P F +P L Sbjct: 572 SILCDRCEEIVPEISLARKIFV------CAVRDVFEGALLPTFDVPDL 613 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,669,159 Number of Sequences: 28952 Number of extensions: 141834 Number of successful extensions: 391 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 391 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 575830496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -