Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV10628
         (720 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A6F7V7 Cluster: Putative uncharacterized protein; n=1; ...    36   0.76 

>UniRef50_A6F7V7 Cluster: Putative uncharacterized protein; n=1;
           Moritella sp. PE36|Rep: Putative uncharacterized protein
           - Moritella sp. PE36
          Length = 488

 Score = 36.3 bits (80), Expect = 0.76
 Identities = 21/65 (32%), Positives = 32/65 (49%)
 Frame = -1

Query: 591 IILSRGKKNSKYNPLSSIILIVYESPKLTTCQVAVMNIFQCSTSEDKNNVKLTLQKNTFK 412
           I LSR   NSK+      IL    S  + +  V V N  +CS      NVK TL+   ++
Sbjct: 308 INLSRSTDNSKFKCYFDEILATQSSEVMNSIDVEVDNWDECSDKAIAGNVKQTLKTKDYQ 367

Query: 411 DSLVV 397
           D++++
Sbjct: 368 DNVLI 372


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 605,989,004
Number of Sequences: 1657284
Number of extensions: 11167302
Number of successful extensions: 20942
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 20057
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20938
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 58264468239
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)