BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10627 (755 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0DLJ9 Cluster: Os03g0860700 protein; n=5; Oryza sativa... 34 4.4 >UniRef50_Q0DLJ9 Cluster: Os03g0860700 protein; n=5; Oryza sativa|Rep: Os03g0860700 protein - Oryza sativa subsp. japonica (Rice) Length = 1457 Score = 33.9 bits (74), Expect = 4.4 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 1/84 (1%) Frame = +3 Query: 228 SPRNMEVNKLTNY-NNCKVVVQKINDINI*C*EGFVPFCKFRNKIYRQIVPFVYNKNLQK 404 +PR+ + LT+ NN + +V +ND+ E VP F KI+ QI F+ + Sbjct: 1235 TPRSAKAGLLTDQGNNWQAIVNHLNDLLKTLQENCVPSI-FARKIFTQIFSFINAQLFNS 1293 Query: 405 NINIEQCCTINSERFK*HRTQVLE 476 + +CC+ ++ + Q LE Sbjct: 1294 LLVRRECCSFSNGEYVKQGLQELE 1317 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 684,705,122 Number of Sequences: 1657284 Number of extensions: 13270660 Number of successful extensions: 29348 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 27997 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29340 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 62558016040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -