BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10627 (755 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g24610.1 68416.m03091 kelch repeat-containing F-box family pr... 28 5.8 At5g04930.1 68418.m00521 phospholipid-transporting ATPase 1 / am... 28 7.7 >At3g24610.1 68416.m03091 kelch repeat-containing F-box family protein contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 445 Score = 28.3 bits (60), Expect = 5.8 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -1 Query: 395 IFIIDKWDNLPIYFIPELTKWDK 327 I+++D WD Y++P + W+K Sbjct: 248 IYVVDSWDVGSYYYLPSKSIWEK 270 >At5g04930.1 68418.m00521 phospholipid-transporting ATPase 1 / aminophospholipid flippase 1 / magnesium-ATPase 1 (ALA1) nearly identical to SP|P98204 Phospholipid-transporting ATPase 1 (EC 3.6.3.1) (Aminophospholipid flippase 1) {Arabidopsis thaliana}; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 1158 Score = 27.9 bits (59), Expect = 7.7 Identities = 17/68 (25%), Positives = 31/68 (45%) Frame = -1 Query: 434 YCATLFYVNIFL*IFIIDKWDNLPIYFIPELTKWDKTFSTSNIDIIYFLNNHFTVIIVRK 255 Y TLF+ + I W + I+FIP W T TS++ ++ + V++V Sbjct: 994 YSTTLFWYTM-----IDTIWQSAAIFFIPMFAYWGSTIDTSSLGDLWTI---AAVVVVNL 1045 Query: 254 FIYLHISR 231 + + + R Sbjct: 1046 HLAMDVIR 1053 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,025,917 Number of Sequences: 28952 Number of extensions: 295036 Number of successful extensions: 546 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -